StarFunc result for job id Q9BV87

User Input

>input (410 residues)
MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD
IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS
DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE
IFEVLSWLESCVAEQQGRWRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV
SSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEPCIPSVPQCLPSLANVSSCLE
GSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCHACLHPNRTVP
TALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P87049	0.304	0.303	1.492E-6	411	0.176	0.175	P87049.pdb.gz	CGP1_SCHPO G1/S-specific cyclin pas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pas1 PE=2 SV=3
2	AFDB:Q57XT7	0.291	0.175	7.765E-5	724	0.124	0.070	Q57XT7.pdb.gz	Q57XT7_TRYB2 CYC2-like cyclin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.170 PE=4 SV=1
3	PDB:2pk9D	0.276	0.492	1.498E-3	219	0.076	0.142	2pk9D.pdb.gz
4	AFDB:Q5A4H9	0.188	0.180	7.923E-3	434	0.129	0.122	Q5A4H9.pdb.gz	SSN8_CANAL RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN8 PE=3 SV=1
5	AFDB:Q7TQK0	0.223	0.139	8.287E-3	723	0.117	0.066	Q7TQK0.pdb.gz	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
6	AFDB:O60583	0.226	0.139	2.128E-2	730	0.124	0.070	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
7	AFDB:Q9VRM0	0.115	0.102	6.539E-2	542	0.124	0.094	Q9VRM0.pdb.gz	Q9VRM0_DROME Leucokinin receptor OS=Drosophila melanogaster OX=7227 GN=Lkr PE=3 SV=2
8	AFDB:Q961D1	0.215	0.220	7.482E-2	400	0.141	0.145	Q961D1.pdb.gz	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
9	AFDB:Q9VK91	0.090	0.093	1.341E-1	395	0.115	0.119	Q9VK91.pdb.gz	FAM92_DROME CBY1-interacting BAR domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Fam92 PE=1 SV=2
10	PDB:2w96A	0.157	0.238	1.748E-1	249	0.068	0.112	2w96A.pdb.gz
11	PDB:3g33B	0.160	0.258	1.748E-1	229	0.078	0.140	3g33B.pdb.gz
12	PDB:5hbhB	0.218	0.311	1.829E-1	270	0.090	0.137	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
13	AFDB:A0A2R8QMI5	0.106	0.086	2.009E-1	576	0.112	0.080	A0A2R8QMI5.pdb.gz	A0A2R8QMI5_DANRE Bridging integrator 1b OS=Danio rerio OX=7955 GN=bin1 PE=1 SV=1
14	AFDB:O14200	0.117	0.100	2.299E-1	495	0.156	0.129	O14200.pdb.gz	PXA1_SCHPO PXA domain protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pxa1 PE=2 SV=1
15	PDB:5iy7M	0.186	0.237	2.739E-1	310	0.063	0.084	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
16	PDB:7kueB	0.204	0.344	2.997E-1	225	0.054	0.098	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
17	PDB:1rqiA	0.135	0.169	3.429E-1	300	0.049	0.067	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
18	PDB:1g3nC	0.193	0.315	4.489E-1	233	0.054	0.094	1g3nC.pdb.gz
19	PDB:7kpvB	0.199	0.276	4.489E-1	290	0.061	0.086	7kpvB.pdb.gz
20	PDB:6eu0Z	0.139	0.163	7.034E-1	339	0.059	0.071	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O80513	3.28e-07	52.8	202	0.076	0.153	CCU41_ARATH Cyclin-U4-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-1 PE=1 SV=1
2	P87049	3.69e-04	44.7	411	0.083	0.083	CGP1_SCHPO G1/S-specific cyclin pas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pas1 PE=2 SV=3
3	Q75J86	5.19e-04	44.7	798	0.071	0.036	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
4	P20052	0.004	41.6	293	0.068	0.096	PHO80_YEAST PHO85 cyclin PHO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO80 PE=1 SV=3
5	P35190	0.019	39.7	452	0.044	0.040	CLG1_YEAST PHO85 cyclin CLG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLG1 PE=1 SV=1
6	Q86VF2	0.024	39.7	1251	0.054	0.018	IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IGFN1 PE=1 SV=2
7	Q9LJ45	0.041	37.7	210	0.063	0.124	CCU11_ARATH Cyclin-U1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCU1-1 PE=1 SV=1
8	O14336	0.059	38.1	461	0.063	0.056	MUG80_SCHPO Meiotically up-regulated gene 80 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug80 PE=1 SV=1
9	G5EAX4	0.079	37.4	420	0.073	0.071	G5EAX4_EMENI Cyclin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00453 PE=4 SV=1
10	Q7K6A7	0.16	35.8	229	0.063	0.114	Q7K6A7_PLAF7 Cyclin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518400 PE=3 SV=1
11	Q12477	0.22	35.8	304	0.076	0.102	PCL9_YEAST PHO85 cyclin-9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL9 PE=1 SV=1
12	Q382C9	0.46	34.3	211	0.059	0.114	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
13	Q9NG22	0.46	34.3	211	0.059	0.114	Q9NG22_9TRYP Cyclin OS=Trypanosoma brucei OX=5691 GN=CYC2 PE=2 SV=1
14	A0A8I6A5E1	0.63	35.0	1247	0.061	0.020	A0A8I6A5E1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
15	P25693	1.0	33.9	308	0.063	0.084	PCL2_YEAST PHO85 cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL2 PE=1 SV=2
16	Q53EQ6	1.3	33.9	642	0.044	0.028	TIGD5_HUMAN Tigger transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=TIGD5 PE=1 SV=3
17	F8VXC8	1.5	33.5	1245	0.059	0.019	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
18	Q9VPI9	1.5	33.9	2064	0.061	0.012	Q9VPI9_DROME LD20667p OS=Drosophila melanogaster OX=7227 GN=Zir PE=2 SV=2
19	I3L2J8	2.6	32.7	1047	0.046	0.018	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
20	Q9UPN4	3.0	32.7	1083	0.046	0.018	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15510 CENP-W	3.9e+02	12.7	CENP-W protein
2	PF08613 Cyclin	0.016	27.1	Cyclin
3	PF00134 Cyclin_N	2.5	19.3	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386277

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377547	0.796	Cyclin-J-like protein
2	9606.ENSP00000369390	0.795	Cyclin-dependent kinase 14
3	9606.ENSP00000257904	0.783	Cyclin-dependent kinase 4
4	9606.ENSP00000265734	0.783	Cyclin-dependent kinase 6
5	9606.ENSP00000266970	0.783	Cyclin-dependent kinase 2
6	9606.ENSP00000378699	0.783	Cyclin-dependent kinase 1
7	9606.ENSP00000480364	0.737	RCC1-like G exchanging factor-like protein
8	9606.ENSP00000478257	0.734	Cyclin-I2
9	9606.ENSP00000256897	0.731	Cyclin-H
10	9606.ENSP00000396755	0.709	Cyclin N-terminal domain containing 2
11	9606.ENSP00000435373	0.680	Cyclin-J
12	9606.ENSP00000282572	0.675	Cyclin-O
13	9606.ENSP00000237654	0.668	Cyclin-I
14	9606.ENSP00000261900	0.653	Cyclin-T1
15	9606.ENSP00000264157	0.653	Cyclin-T2
16	9606.ENSP00000374529	0.653	Cyclin-K
17	9606.ENSP00000315743	0.649	Cyclin-G2
18	9606.ENSP00000344635	0.647	Cyclin-G1
19	9606.ENSP00000368305	0.645	Glycerophosphocholine phosphodiesterase GPCPD1
20	9606.ENSP00000256442	0.640	G2/mitotic-specific cyclin-B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016538	0.542	cyclin-dependent protein serine/threonine kinase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.881	regulation of metabolic process
GO:0008152	0.787	metabolic process
GO:0031323	0.745	regulation of cellular metabolic process
GO:0080090	0.621	regulation of primary metabolic process
GO:0044237	0.618	cellular metabolic process
GO:0051171	0.617	regulation of nitrogen compound metabolic process
GO:0071704	0.615	organic substance metabolic process
GO:0060255	0.576	regulation of macromolecule metabolic process
GO:0044238	0.522	primary metabolic process
GO:0051726	0.522	regulation of cell cycle
GO:0051246	0.499	regulation of protein metabolic process
GO:0065009	0.459	regulation of molecular function
GO:0048518	0.443	positive regulation of biological process
GO:0048519	0.405	negative regulation of biological process
GO:0048522	0.360	positive regulation of cellular process
GO:0048523	0.318	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0032991	0.997	protein-containing complex
GO:0005737	0.993	cytoplasm
GO:1902494	0.974	catalytic complex
GO:0016020	0.969	membrane
GO:0005634	0.835	nucleus
GO:0012505	0.819	endomembrane system
GO:0043233	0.681	organelle lumen
GO:1990234	0.623	transferase complex
GO:0005829	0.583	cytosol
GO:1902554	0.449	serine/threonine protein kinase complex
GO:0070013	0.375	intracellular organelle lumen
GO:0031981	0.366	nuclear lumen
GO:0005783	0.353	endoplasmic reticulum
GO:0005654	0.350	nucleoplasm
GO:0000307	0.337	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]