StarFunc result for job id Q9BVA6

User Input

>input (458 residues)
MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYL
LRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQG
KREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNR
DRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTL
SEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGY
VDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLV
YIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAK
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BVA6	1.000	1.000	3.208E-62	458	1.000	1.000	Q9BVA6.pdb.gz	FICD_HUMAN Protein adenylyltransferase FICD OS=Homo sapiens OX=9606 GN=FICD PE=1 SV=2
2	AFDB:Q8SWV6	0.735	0.684	1.567E-34	492	0.459	0.427	Q8SWV6.pdb.gz	FICD_DROME Protein adenylyltransferase Fic OS=Drosophila melanogaster OX=7227 GN=Fic PE=1 SV=1
3	AFDB:Q23544	0.706	0.638	7.289E-29	508	0.360	0.325	Q23544.pdb.gz	FICD_CAEEL Protein adenylyltransferase fic-1 OS=Caenorhabditis elegans OX=6239 GN=fic-1 PE=1 SV=2
4	AFDB:Q83EF1	0.293	0.296	7.313E-7	454	0.120	0.121	Q83EF1.pdb.gz	Q83EF1_COXBU Fic family protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=CBU_0372 PE=4 SV=1
5	PDB:3zecB	0.398	0.481	4.100E-6	371	0.105	0.129	3zecB.pdb.gz	Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
6	PDB:5cklA	0.285	0.657	2.193E-5	181	0.081	0.204	5cklA.pdb.gz
7	AFDB:E6Z0R3	0.306	0.294	9.760E-5	478	0.087	0.084	E6Z0R3.pdb.gz	VBHT_BARSR Protein adenylyltransferase VbhT OS=Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) OX=687861 GN=vbhT PE=1 SV=1
8	PDB:5jffA	0.300	0.677	1.610E-4	188	0.072	0.176	5jffA.pdb.gz
9	AFDB:P38825	0.180	0.130	5.979E-4	639	0.127	0.091	P38825.pdb.gz	TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM71 PE=1 SV=1
10	AFDB:A0A1W2PNX8	0.213	0.095	9.842E-4	1084	0.155	0.065	A0A1W2PNX8.pdb.gz	A0A1W2PNX8_HUMAN Unc-45 myosin chaperone A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1
11	AFDB:Q8CGY6	0.218	0.114	1.128E-3	931	0.116	0.057	Q8CGY6.pdb.gz	UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus OX=10090 GN=Unc45b PE=1 SV=1
12	AFDB:O18158	0.166	0.071	1.235E-3	1151	0.116	0.046	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
13	AFDB:O14217	0.184	0.138	1.480E-3	625	0.114	0.083	O14217.pdb.gz	TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom70 PE=1 SV=1
14	PDB:7dhgC	0.191	0.186	9.505E-3	470	0.085	0.083	7dhgC.pdb.gz
15	PDB:7r5j00	0.154	0.097	2.576E-2	756	0.103	0.062	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:2fi7A	0.182	0.359	2.951E-2	223	0.070	0.143	2fi7A.pdb.gz
17	PDB:6yj6A	0.170	0.098	3.088E-2	819	0.087	0.049	6yj6A.pdb.gz
18	PDB:7ntfA	0.170	0.086	3.088E-2	918	0.116	0.058	7ntfA.pdb.gz
19	PDB:7kw7E	0.178	0.244	4.642E-2	327	0.090	0.125	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
20	PDB:5wqlA	0.177	0.293	7.996E-2	270	0.083	0.141	5wqlA.pdb.gz	Structural basis of adaptor-mediated protein degradation by the tail-specific PDZ-protease Prc

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A061I403	0.0	810	455	0.897	0.903	FICD_CRIGR Protein adenylyltransferase FICD OS=Cricetulus griseus OX=10029 GN=FICD PE=1 SV=1
2	Q9BVA6	0.0	949	458	1.000	1.000	FICD_HUMAN Protein adenylyltransferase FICD OS=Homo sapiens OX=9606 GN=FICD PE=1 SV=2
3	Q8SWV6	1.09e-132	394	492	0.417	0.388	FICD_DROME Protein adenylyltransferase Fic OS=Drosophila melanogaster OX=7227 GN=Fic PE=1 SV=1
4	Q23544	7.48e-100	310	508	0.334	0.301	FICD_CAEEL Protein adenylyltransferase fic-1 OS=Caenorhabditis elegans OX=6239 GN=fic-1 PE=1 SV=2
5	Q06277	3.44e-10	65.1	4095	0.061	0.007	IBPA_HISS2 Protein adenylyltransferase and cysteine protease IbpA OS=Histophilus somni (strain 2336) OX=228400 GN=ibpA PE=1 SV=2
6	Q8E9K5	9.28e-07	53.1	372	0.072	0.089	SOFIC_SHEON Protein adenylyltransferase SoFic OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=fic PE=1 SV=1
7	E6Z0R3	3.50e-04	45.4	478	0.081	0.077	VBHT_BARSR Protein adenylyltransferase VbhT OS=Bartonella schoenbuchensis (strain DSM 13525 / NCTC 13165 / R1) OX=687861 GN=vbhT PE=1 SV=1
8	Q3UV71	0.002	43.5	942	0.059	0.029	TMTC1_MOUSE Protein O-mannosyl-transferase TMTC1 OS=Mus musculus OX=10090 GN=Tmtc1 PE=2 SV=2
9	Q8IUR5	0.002	42.7	882	0.068	0.035	TMTC1_HUMAN Protein O-mannosyl-transferase TMTC1 OS=Homo sapiens OX=9606 GN=TMTC1 PE=1 SV=3
10	A0A0R4IVJ0	0.004	42.4	1102	0.057	0.024	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
11	Q5GA12	0.004	42.0	1052	0.055	0.024	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
12	Q5GA13	0.004	42.0	1062	0.055	0.024	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
13	Q7DDR9	0.004	40.4	191	0.081	0.194	NMFIC_NEIMB Protein adenylyltransferase NmFic OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=NMB0255 PE=1 SV=1
14	P56558	0.005	42.0	1036	0.055	0.024	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
15	Q5GA10	0.005	42.0	1036	0.055	0.024	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
16	Q5GA11	0.005	42.0	1046	0.055	0.024	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
17	Q8CGY8	0.005	42.0	1046	0.055	0.024	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
18	O15294	0.006	41.6	1046	0.055	0.024	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
19	P81436	0.006	41.6	1046	0.055	0.024	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
20	Q9Y148	0.006	41.6	1011	0.055	0.025	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02661 Fic	9.6e-25	98.7	Fic/DOC family
2	PF00515 TPR_1	2.8e+02	12.8	Tetratricopeptide repeat
3	PF13424 TPR_12	1.3e+02	14.3	Tetratricopeptide repeat
4	PF07719 TPR_2	3.9	18.9	Tetratricopeptide repeat
5	PF13181 TPR_8	11	17.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446479

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000473093	0.818	Melanoma-associated antigen 3
2	9606.ENSP00000448073	0.809	Pre-mRNA-processing factor 40 homolog B
3	9606.ENSP00000365756	0.782	Uncharacterized protein KIAA2013
4	9606.ENSP00000347184	0.751	Huntingtin
5	9606.ENSP00000386458	0.737	Pre-mRNA-processing factor 40 homolog A
6	9606.ENSP00000324173	0.693	78 kDa glucose-regulated protein
7	9606.ENSP00000464813	0.679	60S ribosomal protein L27
8	9606.ENSP00000363970	0.647	Microtubule-associated proteins 1A/1B light chain 3A
9	9606.ENSP00000267889	0.617	Dispatched RND transporter family member 2
10	9606.ENSP00000332454	0.606	Receptor-interacting serine/threonine-protein kinase 4
11	9606.ENSP00000309501	0.604	NACHT and WD repeat domain containing 2
12	9606.ENSP00000368666	0.567	Patched domain-containing protein 1
13	9606.ENSP00000386759	0.559	Histone-lysine N-methyltransferase SETD2
14	9606.ENSP00000379183	0.548	Pannexin-2
15	9606.ENSP00000311427	0.541	Sorting nexin-33
16	9606.ENSP00000311318	0.540	Cysteine protease ATG4D
17	9606.ENSP00000297146	0.531	Probable G-protein coupled receptor 85
18	9606.ENSP00000479101	0.522	Ectoderm-neural cortex protein 1
19	9606.ENSP00000362135	0.519	YrdC domain-containing protein, mitochondrial
20	9606.ENSP00000445359	0.518	Phospholipid-transporting ATPase IC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	0.999	chaperone binding
GO:0030544	0.999	Hsp70 protein binding
GO:0070566	0.999	adenylyltransferase activity
GO:0070733	0.983	protein adenylyltransferase activity
GO:1901363	0.981	heterocyclic compound binding
GO:0097159	0.981	organic cyclic compound binding
GO:0043168	0.976	anion binding
GO:0042802	0.975	identical protein binding
GO:0035639	0.973	purine ribonucleoside triphosphate binding
GO:0042803	0.972	protein homodimerization activity
GO:0097367	0.916	carbohydrate derivative binding
GO:0017076	0.890	purine nucleotide binding
GO:0005524	0.868	ATP binding
GO:0140096	0.775	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1905897	0.997	regulation of response to endoplasmic reticulum stress
GO:1900101	0.994	regulation of endoplasmic reticulum unfolded protein response
GO:0009987	0.985	cellular process
GO:0071704	0.962	organic substance metabolic process
GO:0044238	0.954	primary metabolic process
GO:0006807	0.947	nitrogen compound metabolic process
GO:0043170	0.933	macromolecule metabolic process
GO:0050896	0.866	response to stimulus
GO:0051716	0.834	cellular response to stimulus
GO:1901564	0.824	organonitrogen compound metabolic process
GO:0043412	0.803	macromolecule modification
GO:0048519	0.796	negative regulation of biological process
GO:0019538	0.777	protein metabolic process
GO:0036211	0.724	protein modification process
GO:0006950	0.603	response to stress
GO:0033554	0.343	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.997	endoplasmic reticulum
GO:0031090	0.944	organelle membrane
GO:0005789	0.830	endoplasmic reticulum membrane
GO:0005634	0.575	nucleus
GO:0070013	0.498	intracellular organelle lumen
GO:0071944	0.421	cell periphery
GO:0005886	0.396	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.-	0.999	Nucleotidyltransferases.
EC:2.7.7.n1	0.983	Transferred entry: 2.7.7.108.

[back to server]