StarFunc result for job id Q9BVC3

User Input

>input (393 residues)
MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGH
SLVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFG
FSNNYWELRRRRPKLKKLKKLLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIM
TQLQVLNACKIGGYWRILEFDYEMKLLNHVTQLVDSESWSFGKVPLNTCLQELGPLEPEE
MIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNAVKFNLAEFQEVWQQSVPEGM
VTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDL
CGEKQTIGALLTKYSHSSMQNGVKVYNSRRPIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BVC3	1.000	1.000	2.427E-80	393	1.000	1.000	Q9BVC3.pdb.gz	DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo sapiens OX=9606 GN=DSCC1 PE=1 SV=2
2	AFDB:P25559	0.632	0.650	3.893E-25	380	0.216	0.224	P25559.pdb.gz	DCC1_YEAST Sister chromatid cohesion protein DCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCC1 PE=1 SV=2
3	AFDB:Q09732	0.714	0.779	5.172E-25	357	0.196	0.216	Q09732.pdb.gz	DCC1_SCHPO Sister chromatid cohesion protein dcc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcc1 PE=3 SV=2
4	PDB:5okcB	0.575	0.594	1.264E-23	377	0.226	0.236	5okcB.pdb.gz	Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
5	AFDB:Q57UZ8	0.645	0.561	1.943E-19	460	0.188	0.161	Q57UZ8.pdb.gz	Q57UZ8_TRYB2 Sister chromatid cohesion protein DCC1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.600 PE=3 SV=1
6	PDB:6s1cB	0.539	0.603	5.319E-18	342	0.221	0.254	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
7	PDB:6s1cF	0.539	0.681	5.136E-15	299	0.196	0.258	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
8	AFDB:P41900	0.181	0.242	8.031E-6	277	0.074	0.105	P41900.pdb.gz	T2FB_DROME General transcription factor IIF subunit 2 OS=Drosophila melanogaster OX=7227 GN=TfIIFbeta PE=2 SV=2
9	AFDB:Q9VI55	0.141	0.089	1.035E-4	782	0.117	0.059	Q9VI55.pdb.gz	UFL1_DROME E3 UFM1-protein ligase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Ufl1 PE=1 SV=1
10	AFDB:Q9Y4F3	0.145	0.048	1.455E-4	1742	0.074	0.017	Q9Y4F3.pdb.gz	MARF1_HUMAN Meiosis regulator and mRNA stability factor 1 OS=Homo sapiens OX=9606 GN=MARF1 PE=1 SV=6
11	AFDB:O94874	0.142	0.084	1.630E-4	794	0.104	0.052	O94874.pdb.gz	UFL1_HUMAN E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2
12	AFDB:A0A024RDU9	0.169	0.248	3.044E-4	249	0.074	0.116	A0A024RDU9.pdb.gz
13	AFDB:Q8BJ34	0.156	0.051	3.044E-4	1730	0.079	0.018	Q8BJ34.pdb.gz	MARF1_MOUSE Meiosis regulator and mRNA stability factor 1 OS=Mus musculus OX=10090 GN=Marf1 PE=1 SV=3
14	PDB:7asvA	0.135	0.306	1.798E-3	155	0.056	0.142	7asvA.pdb.gz
15	PDB:5svag	0.159	0.336	3.555E-3	172	0.059	0.134	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
16	PDB:5afqB	0.115	0.103	5.927E-3	444	0.071	0.063	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
17	PDB:6o9lT	0.187	0.289	1.107E-2	237	0.071	0.118	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:7o4iR	0.179	0.248	1.240E-2	268	0.097	0.142	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:1w7pD	0.137	0.255	1.471E-2	171	0.056	0.129	1w7pD.pdb.gz
20	PDB:3cuqA	0.126	0.202	1.557E-2	219	0.041	0.073	3cuqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BVC3	0.0	816	393	1.000	1.000	DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo sapiens OX=9606 GN=DSCC1 PE=1 SV=2
2	Q09732	5.22e-10	62.8	357	0.109	0.120	DCC1_SCHPO Sister chromatid cohesion protein dcc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcc1 PE=3 SV=2
3	P25559	1.59e-08	58.2	380	0.229	0.237	DCC1_YEAST Sister chromatid cohesion protein DCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCC1 PE=1 SV=2
4	Q96BQ3	1.6	33.5	446	0.079	0.070	TRI43_HUMAN Tripartite motif-containing protein 43 OS=Homo sapiens OX=9606 GN=TRIM43 PE=1 SV=1
5	Q4WLW7	1.7	33.1	418	0.069	0.065	FMQB_ASPFU FAD-dependent monooxygenase fmqB OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=fmqB PE=1 SV=1
6	Q9HPR6	1.7	33.1	489	0.066	0.053	HMAT_HALSA Heme-based aerotactic transducer HemAT OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) OX=64091 GN=hemAT PE=3 SV=1
7	A8K8P3	3.8	32.3	1242	0.051	0.016	SFI1_HUMAN Protein SFI1 homolog OS=Homo sapiens OX=9606 GN=SFI1 PE=1 SV=2
8	Q9C8D4	5.2	31.6	572	0.066	0.045	AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=AAE11 PE=1 SV=1
9	Q96D30	6.2	31.2	400	0.036	0.035	Q96D30_HUMAN ADD1 protein OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=1
10	P35611	6.6	31.6	737	0.036	0.019	ADDA_HUMAN Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2
11	Q9QYC0	6.6	31.6	735	0.036	0.019	ADDA_MOUSE Alpha-adducin OS=Mus musculus OX=10090 GN=Add1 PE=1 SV=2
12	Q63028	6.7	31.6	735	0.036	0.019	ADDA_RAT Alpha-adducin OS=Rattus norvegicus OX=10116 GN=Add1 PE=1 SV=2
13	Q09739	8.7	30.4	210	0.074	0.138	MCP7_SCHPO Meiotic coiled-coil protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09724 Dcc1	2.5e-92	321.3	Sister chromatid cohesion protein Dcc1
2	PF15960 DUF4763	41	14.9	Domain of unknown function (DUF4763)
3	PF07544 Med9	1.3e+02	14.1	RNA polymerase II transcription mediator complex subunit 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262315	0.999	Chromosome transmission fidelity protein 18 homolog
2	9606.ENSP00000376272	0.999	Replication factor C subunit 4
3	9606.ENSP00000408367	0.999	Chromosome transmission fidelity protein 8 homolog
4	9606.ENSP00000408295	0.998	Replication factor C subunit 5
5	9606.ENSP00000369411	0.997	Replication factor C subunit 3
6	9606.ENSP00000055077	0.996	Replication factor C subunit 2
7	9606.ENSP00000353793	0.985	WD repeat and HMG-box DNA-binding protein 1
8	9606.ENSP00000350491	0.970	DNA primase small subunit
9	9606.ENSP00000368349	0.955	DNA polymerase alpha catalytic subunit
10	9606.ENSP00000261881	0.950	TIMELESS-interacting protein
11	9606.ENSP00000265465	0.926	DNA polymerase alpha subunit B
12	9606.ENSP00000322570	0.914	DNA polymerase epsilon catalytic subunit A
13	9606.ENSP00000484105	0.914	DNA primase large subunit
14	9606.ENSP00000302530	0.912	Mitotic checkpoint serine/threonine-protein kinase BUB1
15	9606.ENSP00000354720	0.912	Structural maintenance of chromosomes protein 3
16	9606.ENSP00000371321	0.911	Replication factor C subunit 1
17	9606.ENSP00000209728	0.903	Cell division control protein 6 homolog
18	9606.ENSP00000307288	0.889	DNA replication licensing factor MCM7
19	9606.ENSP00000262460	0.886	DNA replication complex GINS protein PSF1
20	9606.ENSP00000306999	0.880	N-acetyltransferase ESCO2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003689	1.000	DNA clamp loader activity
GO:0017116	1.000	single-stranded DNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:1903047	0.991	mitotic cell cycle process
GO:0051052	0.989	regulation of DNA metabolic process
GO:0051276	0.987	chromosome organization
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0000070	0.979	mitotic sister chromatid segregation
GO:0048518	0.978	positive regulation of biological process
GO:0051338	0.975	regulation of transferase activity
GO:0006275	0.973	regulation of DNA replication
GO:2000278	0.966	regulation of DNA biosynthetic process
GO:0009893	0.965	positive regulation of metabolic process
GO:0048522	0.960	positive regulation of cellular process
GO:0007062	0.951	sister chromatid cohesion
GO:0036211	0.938	protein modification process
GO:0007064	0.919	mitotic sister chromatid cohesion
GO:0043543	0.909	protein acylation
GO:0006473	0.878	protein acetylation
GO:0010604	0.849	positive regulation of macromolecule metabolic process
GO:0043687	0.803	post-translational protein modification
GO:0051173	0.790	positive regulation of nitrogen compound metabolic process
GO:0031325	0.740	positive regulation of cellular metabolic process
GO:0045935	0.719	positive regulation of nucleobase-containing compound metabolic process
GO:0051054	0.696	positive regulation of DNA metabolic process
GO:0044237	0.586	cellular metabolic process
GO:0044093	0.581	positive regulation of molecular function
GO:0010557	0.573	positive regulation of macromolecule biosynthetic process
GO:0031328	0.570	positive regulation of cellular biosynthetic process
GO:0090329	0.565	regulation of DNA-templated DNA replication
GO:0051347	0.558	positive regulation of transferase activity
GO:2000573	0.532	positive regulation of DNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.997	nuclear protein-containing complex
GO:0000775	0.996	chromosome, centromeric region
GO:0000785	0.993	chromatin
GO:0005737	0.765	cytoplasm
GO:0031390	0.742	Ctf18 RFC-like complex
GO:0005829	0.349	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]