StarFunc result for job id Q9BVG3

User Input

>input (475 residues)
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALH
EQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGE
AFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETD
RHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD
PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEK
TQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80V85	0.911	0.911	4.527E-87	475	0.992	0.992	Q80V85.pdb.gz	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
2	AFDB:A0A060IVL7	0.602	0.529	9.842E-43	548	0.335	0.290	A0A060IVL7.pdb.gz	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
3	AFDB:Q86WT6	0.671	0.640	1.753E-41	500	0.312	0.296	Q86WT6.pdb.gz	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
4	AFDB:A0A024RCP5	0.394	0.363	1.585E-40	518	0.324	0.297	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
5	AFDB:A0A024RCR1	0.397	0.387	2.491E-40	488	0.326	0.318	A0A024RCR1.pdb.gz
6	AFDB:B3DFR8	0.396	0.360	8.735E-39	532	0.322	0.288	B3DFR8.pdb.gz
7	AFDB:Q6P000	0.391	0.331	1.926E-38	564	0.318	0.268	Q6P000.pdb.gz
8	AFDB:Q810I2	0.396	0.390	5.630E-38	483	0.301	0.296	Q810I2.pdb.gz	TRI50_MOUSE E3 ubiquitin-protein ligase TRIM50 OS=Mus musculus OX=10090 GN=Trim50 PE=1 SV=1
9	AFDB:Q86XT4	0.403	0.394	1.048E-37	487	0.291	0.283	Q86XT4.pdb.gz	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2
10	AFDB:A0A1U9X8R9	0.373	0.346	4.063E-37	513	0.307	0.285	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
11	PDB:7y4sA	0.402	0.546	2.193E-24	343	0.171	0.236	7y4sA.pdb.gz
12	PDB:4b3nA	0.305	0.262	1.065E-14	557	0.105	0.090	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.249	0.657	5.652E-7	164	0.046	0.134	7ccbA.pdb.gz
14	PDB:6swy1	0.245	0.217	3.075E-6	542	0.069	0.061	6swy1.pdb.gz
15	PDB:7nscA	0.262	0.427	6.056E-6	276	0.063	0.109	7nscA.pdb.gz
16	PDB:7z36B	0.238	0.248	7.686E-5	446	0.088	0.094	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
17	PDB:7nsba	0.238	0.203	8.133E-5	568	0.074	0.062	7nsba.pdb.gz
18	PDB:7m6aA	0.225	0.028	2.247E-4	4306	0.063	0.007	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
19	PDB:7vmlA	0.176	0.024	8.713E-4	4044	0.055	0.006	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
20	PDB:2a3wA	0.134	0.266	1.032E-3	204	0.040	0.093	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80V85	0.0	984	475	0.992	0.992	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
2	Q9BVG3	0.0	988	475	1.000	1.000	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
3	E7F8P0	7.64e-92	291	548	0.341	0.296	E7F8P0_DANRE Tripartite motif-containing 69 OS=Danio rerio OX=7955 GN=rnf36 PE=4 SV=1
4	A0A060IVL7	2.75e-91	290	548	0.339	0.294	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
5	A0A024RCP5	7.82e-73	241	518	0.335	0.307	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
6	Q9HCM9	7.82e-73	241	518	0.335	0.307	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
7	Q86WT6	4.67e-71	235	500	0.314	0.298	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
8	Q810I2	2.96e-67	225	483	0.303	0.298	TRI50_MOUSE E3 ubiquitin-protein ligase TRIM50 OS=Mus musculus OX=10090 GN=Trim50 PE=1 SV=1
9	Q86XT4	9.84e-65	218	487	0.295	0.287	TRI50_HUMAN E3 ubiquitin-protein ligase TRIM50 OS=Homo sapiens OX=9606 GN=TRIM50 PE=1 SV=2
10	A0A1U9X8R9	2.28e-60	207	513	0.307	0.285	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
11	P14373	2.28e-60	207	513	0.307	0.285	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
12	Q62158	3.81e-59	204	513	0.305	0.283	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
13	Q6AZZ1	9.43e-59	202	485	0.312	0.305	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
14	P19474	2.97e-58	201	475	0.314	0.314	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
15	Q1XH17	7.47e-58	200	477	0.272	0.270	TRI72_MOUSE Tripartite motif-containing protein 72 OS=Mus musculus OX=10090 GN=Trim72 PE=1 SV=1
16	A0A0R4IUT0	2.87e-56	197	544	0.337	0.294	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
17	Q5NCC9	3.55e-55	193	485	0.278	0.272	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
18	Q6ZMU5	1.29e-53	189	477	0.261	0.260	TRI72_HUMAN Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2
19	Q96F44	2.57e-53	187	468	0.320	0.325	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
20	Q3U7K7	4.73e-53	187	462	0.305	0.314	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	58	13.9	AAA domain
2	PF01544 CorA	35	15.2	CorA-like Mg2+ transporter protein
3	PF07889 DUF1664	2.9e+02	12.9	Protein of unknown function (DUF1664)
4	PF09537 DUF2383	2.7e+02	13.2	Domain of unknown function (DUF2383)
5	PF11101 DUF2884	6.8e+02	11.3	Protein of unknown function (DUF2884)
6	PF02601 Exonuc_VII_L	2.3e+02	12.7	Exonuclease VII, large subunit
7	PF08702 Fib_alpha	2.3e+02	13.3	Fibrinogen alpha/beta chain family
8	PF11896 GlgE_dom_N_S	8.5	18.1	Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase, domain N/S
9	PF10241 KxDL	33	16.2	Uncharacterized conserved protein
10	PF04740 LXG	6.8e+02	11.5	LXG domain of WXG superfamily
11	PF05597 Phasin	1.9e+02	13.5	Poly(hydroxyalcanoate) granule associated protein (phasin)
12	PF14447 Prok-RING_4	7.1e+02	11.5	Prokaryotic RING finger family 4
13	PF13765 PRY	3.9e-14	63.3	SPRY-associated domain
14	PF01780 Ribosomal_L37ae	56	15.3	Ribosomal L37ae protein family
15	PF08286 Spc24	9.8e+02	11.4	Spc24 subunit of Ndc80
16	PF00622 SPRY	1.4e-11	55.9	SPRY domain
17	PF15194 TMEM191C	2.4e+02	13.3	TMEM191C family
18	PF04564 U-box	79	14.9	U-box domain
19	PF04871 Uso1_p115_C	9.1e+02	11.5	Uso1 / p115 like vesicle tethering protein, C terminal region
20	PF12861 zf-ANAPC11	71	14.9	Anaphase-promoting complex subunit 11 RING-H2 finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360797	0.843	Caspase recruitment domain-containing protein 9
2	9606.ENSP00000321346	0.722	Tubulin polyglutamylase TTLL11
3	9606.ENSP00000361180	0.690	General transcription factor 3C polypeptide 5
4	9606.ENSP00000295756	0.688	T-cell receptor-associated transmembrane adapter 1
5	9606.ENSP00000263266	0.682	Protein FAM83E
6	9606.ENSP00000230361	0.669	Guanylyl cyclase-activating protein 2
7	9606.ENSP00000355053	0.659	Zinc finger and SCAN domain-containing protein 20
8	9606.ENSP00000270221	0.653	Epithelial membrane protein 3
9	9606.ENSP00000446335	0.650	Zinc finger protein 362
10	9606.ENSP00000360829	0.649	Belongs to the glycosyltransferase 6 family
11	9606.ENSP00000241014	0.627	C-Jun-amino-terminal kinase-interacting protein 1
12	9606.ENSP00000262294	0.608	E3 ubiquitin-protein ligase TRIM37
13	9606.ENSP00000334657	0.583	Tripartite motif-containing protein 46
14	9606.ENSP00000263182	0.582	Gamma-butyrobetaine dioxygenase
15	9606.ENSP00000286713	0.560	Erythrocyte band 7 integral membrane protein
16	9606.ENSP00000408292	0.560	E3 ubiquitin-protein ligase TRIM32
17	9606.ENSP00000259371	0.558	Disabled homolog 2-interacting protein
18	9606.ENSP00000428876	0.551	Protein FAM83A
19	9606.ENSP00000381717	0.548	Ubiquitin-conjugating enzyme E2 D2
20	9606.ENSP00000384876	0.537	Tripartite motif-containing protein 66

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0042802	0.998	identical protein binding
GO:0003713	0.997	transcription coactivator activity
GO:0019899	0.825	enzyme binding
GO:0061659	0.449	ubiquitin-like protein ligase activity
GO:0061630	0.376	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0048518	0.981	positive regulation of biological process
GO:1900150	0.973	regulation of defense response to fungus
GO:0002682	0.970	regulation of immune system process
GO:0048584	0.956	positive regulation of response to stimulus
GO:0048519	0.933	negative regulation of biological process
GO:0050776	0.930	regulation of immune response
GO:0045089	0.917	positive regulation of innate immune response
GO:0019222	0.913	regulation of metabolic process
GO:0071704	0.882	organic substance metabolic process
GO:0050792	0.881	regulation of viral process
GO:0048522	0.861	positive regulation of cellular process
GO:0009987	0.860	cellular process
GO:0050896	0.850	response to stimulus
GO:0044238	0.828	primary metabolic process
GO:0006807	0.820	nitrogen compound metabolic process
GO:0031323	0.813	regulation of cellular metabolic process
GO:0043903	0.786	regulation of biological process involved in symbiotic interaction
GO:0002376	0.751	immune system process
GO:0080090	0.750	regulation of primary metabolic process
GO:0051239	0.728	regulation of multicellular organismal process
GO:0048523	0.714	negative regulation of cellular process
GO:0060255	0.703	regulation of macromolecule metabolic process
GO:0044419	0.674	biological process involved in interspecies interaction between organisms
GO:0043170	0.661	macromolecule metabolic process
GO:0051171	0.659	regulation of nitrogen compound metabolic process
GO:0010468	0.659	regulation of gene expression
GO:0006355	0.637	regulation of DNA-templated transcription
GO:1901564	0.575	organonitrogen compound metabolic process
GO:0019538	0.545	protein metabolic process
GO:0044093	0.526	positive regulation of molecular function
GO:0051091	0.521	positive regulation of DNA-binding transcription factor activity
GO:0036211	0.501	protein modification process
GO:0050793	0.486	regulation of developmental process
GO:0051092	0.475	positive regulation of NF-kappaB transcription factor activity
GO:0010717	0.447	regulation of epithelial to mesenchymal transition
GO:0046596	0.428	regulation of viral entry into host cell
GO:0032446	0.413	protein modification by small protein conjugation
GO:0009966	0.410	regulation of signal transduction
GO:0010647	0.353	positive regulation of cell communication
GO:0023056	0.349	positive regulation of signaling
GO:0016567	0.337	protein ubiquitination
GO:0051716	0.324	cellular response to stimulus
GO:0009967	0.311	positive regulation of signal transduction
GO:0043122	0.310	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048525	0.308	negative regulation of viral process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043226	0.933	organelle
GO:0043227	0.895	membrane-bounded organelle
GO:0043229	0.866	intracellular organelle
GO:0043231	0.714	intracellular membrane-bounded organelle
GO:0005634	0.566	nucleus
GO:0016020	0.315	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]