StarFunc result for job id Q9BVH7

User Input

>input (336 residues)
MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAA
ESSTQQRPGVPAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECV
IRMNDAPTRGYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRD
GKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTI
ALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITE
KRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BVH7	1.000	1.000	3.245E-71	336	1.000	1.000	Q9BVH7.pdb.gz	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
2	AFDB:Q8NDV1	0.734	0.808	5.819E-36	305	0.333	0.367	Q8NDV1.pdb.gz	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
3	AFDB:Q9H4F1	0.738	0.819	7.947E-36	302	0.372	0.414	Q9H4F1.pdb.gz	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
4	AFDB:Q64686	0.734	0.808	1.679E-35	305	0.307	0.338	Q64686.pdb.gz	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
5	AFDB:Q969X2	0.729	0.735	1.679E-35	333	0.408	0.411	Q969X2.pdb.gz	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
6	AFDB:Q6KC03	0.515	0.486	3.422E-14	358	0.176	0.165	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
7	AFDB:Q6ZXA0	0.491	0.463	4.674E-14	359	0.155	0.145	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
8	AFDB:Q1LVN2	0.478	0.428	1.436E-13	381	0.193	0.171	Q1LVN2.pdb.gz
9	AFDB:O35696	0.516	0.469	1.528E-13	375	0.226	0.203	O35696.pdb.gz	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
10	AFDB:O43173	0.481	0.431	1.731E-13	380	0.170	0.150	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
11	PDB:6aplC	0.454	0.495	9.094E-10	306	0.164	0.180	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:1oc4A	0.161	0.169	6.079E-2	315	0.042	0.044	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
13	PDB:1eghA	0.143	0.243	7.330E-2	152	0.054	0.118	1eghA.pdb.gz	Mirroring perfection: the structure of methylglyoxal synthase complexed with the competitive inhibitor 2-phosphoglycolate.
14	PDB:3nl2C	0.167	0.130	9.406E-2	498	0.071	0.048	3nl2C.pdb.gz
15	PDB:3cosD	0.122	0.113	1.001E-1	381	0.039	0.034	3cosD.pdb.gz	Crystal structure of human class II alcohol dehydrogenase (ADH4) in complex with NAD and Zn.
16	PDB:3vzxB	0.184	0.239	1.065E-1	228	0.051	0.075	3vzxB.pdb.gz	Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
17	PDB:2a5lB	0.154	0.231	1.207E-1	175	0.045	0.086	2a5lB.pdb.gz	The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
18	PDB:2plaA	0.155	0.152	1.207E-1	343	0.068	0.067	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
19	PDB:7ln6F	0.124	0.073	1.207E-1	714	0.048	0.022	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
20	PDB:2zwaB	0.126	0.080	1.285E-1	683	0.036	0.018	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BVH7	0.0	708	336	1.000	1.000	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
2	Q9QYJ1	0.0	610	336	0.911	0.911	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
3	Q969X2	6.20e-93	281	333	0.378	0.381	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
4	Q9JM95	1.92e-91	278	333	0.369	0.372	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
5	Q9H4F1	2.47e-81	251	302	0.372	0.414	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
6	Q8NDV1	1.80e-71	226	305	0.318	0.351	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
7	Q64686	1.95e-71	226	305	0.310	0.341	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
8	A0A087WWK2	1.08e-35	128	139	0.164	0.396	A0A087WWK2_HUMAN ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
9	Q96JF0	3.18e-16	81.6	529	0.173	0.110	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
10	Q8QH83	2.37e-15	78.6	381	0.193	0.171	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
11	Q76K27	3.65e-15	78.6	524	0.167	0.107	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
12	Q07977	3.76e-15	77.8	375	0.211	0.189	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
13	O35696	4.41e-15	77.4	375	0.211	0.189	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
14	Q92186	2.36e-14	75.5	375	0.208	0.187	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
15	P15907	3.57e-14	75.1	406	0.164	0.135	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
16	B0CN48	6.02e-14	74.3	374	0.176	0.158	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
17	O43173	6.56e-14	73.9	380	0.173	0.153	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
18	P97325	2.84e-13	72.0	374	0.190	0.171	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
19	Q02734	3.39e-13	72.0	374	0.188	0.168	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
20	Q64689	5.64e-13	71.2	380	0.167	0.147	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11022 ATP19	1.9e+02	13.8	ATP synthase subunit K
2	PF00777 Glyco_transf_29	8.1e-34	129.0	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321343	0.961	Alpha-2,8-sialyltransferase 8E
2	9606.ENSP00000428540	0.922	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
3	9606.ENSP00000377257	0.916	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
4	9606.ENSP00000419194	0.708	Microseminoprotein, prostate associated
5	9606.ENSP00000359892	0.606	Choline transporter-like protein 5
6	9606.ENSP00000297273	0.583	N-acetylneuraminate 9-O-acetyltransferase
7	9606.ENSP00000343002	0.558	Beta-1,3-glucosyltransferase
8	9606.ENSP00000230990	0.545	Proheparin-binding EGF-like growth factor
9	9606.ENSP00000446278	0.535	Leucine rich repeats and transmembrane domains 2
10	9606.ENSP00000373979	0.521	Trafficking protein particle complex subunit 9
11	9606.ENSP00000156626	0.518	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
12	9606.ENSP00000291294	0.514	Prostacyclin receptor
13	9606.ENSP00000398778	0.513	RELT-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0001665	0.876	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
GO:0005488	0.816	binding
GO:0005515	0.781	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:1901135	0.994	carbohydrate derivative metabolic process
GO:0005975	0.992	carbohydrate metabolic process
GO:0044237	0.990	cellular metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0006688	0.970	glycosphingolipid biosynthetic process
GO:0009311	0.967	oligosaccharide metabolic process
GO:0009312	0.809	oligosaccharide biosynthetic process
GO:0043170	0.358	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.876	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.876	Transferred entry: 2.4.3.3.

[back to server]