StarFunc result for job id Q9BVR0

User Input

>input (1158 residues)
MHAFCVGQYLEPDQEGVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIEC
AKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQ
AIADNNIQDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHV
ALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERL
RFLFNELRPAVCNDLSIMSKFKLLSSLPHWRRIAQKIIREPRKKRVPKKPESTDDEEKIG
NEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQS
PLLSTIAEFALKEEPVDVEKRKCLLKQLERAEVRLEGIDTILKLYLVSKNFLLPSVPYAM
FCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLVDASA
KFKELGIQPVPLQTITNENPSGPSLGTIPQAHFLLVMLSMLTLQHSANNLDLLLNSGTLA
LAQTALRLIGPSCDSVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTR
VMRGVDWKWGDQDRPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGNYDLKLAELP
APAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKT
LCGLLQMLVYREQHRSWCTLGFVQSIALTLQVCGTLSSLQWITLLMKVVEGHAPFTATSL
QRQILAVHLLQAVLPSWDKTERARDMKCLMEKLFDFLGSLLTMCSSDVPLLRESTLRRRR
VCPQASLTATHSSTLAEEVVALLHTLHSLTQWNGLINKYINSQLRSITHSFAGRPSKGAQ
LEDYFPDSENPEVGGLMAVLAVVGGIDGRLCLGGQVVHDDFGEVTMTRITLKGKITVQFS
DMRTCHVCPLNQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAF
AGQVDLDLLRCQQLKLYILKAGRALFSHQDKLRQILSQPAVQETGTVHTDDGAVVSPDLG
DMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEERMSRCCFWRRRTTKLEQILLFI
RRMNSVCEKENTNATASN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jq9A	0.145	0.087	3.400E-4	2427	0.110	0.052	7jq9A.pdb.gz
2	PDB:7mopA	0.124	0.078	2.177E-3	2445	0.104	0.049	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
3	AFDB:Q9VZ07	0.086	0.094	2.258E-3	1038	0.093	0.104	Q9VZ07.pdb.gz	Q9VZ07_DROME Kinesin associated protein 3, isoform G OS=Drosophila melanogaster OX=7227 GN=Kap3 PE=2 SV=4
4	PDB:7qenD	0.128	0.137	7.606E-3	1050	0.086	0.095	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
5	AFDB:P40468	0.129	0.079	1.047E-2	2376	0.096	0.047	P40468.pdb.gz	TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAO3 PE=1 SV=1
6	PDB:6q82A	0.106	0.116	1.139E-2	1027	0.091	0.102	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
7	PDB:6swy5	0.124	0.163	1.511E-2	789	0.083	0.122	6swy5.pdb.gz
8	PDB:7r5jC0	0.131	0.090	1.775E-2	2011	0.117	0.068	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
9	AFDB:Q96UP3	0.143	0.124	1.997E-2	1400	0.098	0.081	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
10	AFDB:F1RCP0	0.137	0.095	2.079E-2	2059	0.101	0.057	F1RCP0.pdb.gz
11	AFDB:Q57Y20	0.118	0.135	2.254E-2	915	0.098	0.123	Q57Y20.pdb.gz	Q57Y20_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.370 PE=4 SV=1
12	PDB:3w3uA	0.090	0.097	2.355E-2	1030	0.088	0.099	3w3uA.pdb.gz
13	PDB:4bsmA	0.113	0.132	3.671E-2	896	0.077	0.099	4bsmA.pdb.gz
14	PDB:7ni5A	0.119	0.065	3.671E-2	2791	0.106	0.044	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
15	PDB:3icqT	0.082	0.091	4.144E-2	949	0.080	0.098	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
16	AFDB:Q57Z70	0.125	0.084	5.703E-2	2181	0.111	0.059	Q57Z70.pdb.gz	Q57Z70_TRYB2 Non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.280 PE=4 SV=1
17	AFDB:P0CE41	0.084	0.074	6.978E-2	1502	0.100	0.077	P0CE41.pdb.gz	HAP1_YEAST Heme-responsive zinc finger transcription factor HAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP1 PE=1 SV=1
18	AFDB:Q54BP6	0.059	0.068	8.201E-2	783	0.085	0.125	Q54BP6.pdb.gz	EXOC3_DICDI Exocyst complex component 3 OS=Dictyostelium discoideum OX=44689 GN=exoc3 PE=3 SV=1
19	AFDB:D4A208	0.052	0.054	8.538E-2	1071	0.106	0.115	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
20	AFDB:Q6DFZ1	0.182	0.128	8.890E-2	1861	0.118	0.074	Q6DFZ1.pdb.gz	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95714	0.0	2204	4834	0.934	0.224	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
2	Q4U2R1	0.0	2082	4836	0.880	0.211	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
3	Q69ZR2	3.97e-17	90.1	2618	0.042	0.019	HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus OX=10090 GN=Hectd1 PE=1 SV=2
4	Q9ULT8	4.00e-17	90.1	2610	0.042	0.019	HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=4
5	Q9VL06	1.43e-14	81.6	2727	0.040	0.017	UFD4_DROME E3 ubiquitin-protein ligase Ufd4 OS=Drosophila melanogaster OX=7227 GN=Ufd4 PE=2 SV=1
6	V6CLA2	6.79e-10	66.2	2648	0.022	0.010	HECD1_CAEEL E3 ubiquitin-protein ligase hecd-1 OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
7	V6CLA7	6.91e-10	66.2	2650	0.022	0.010	V6CLA7_CAEEL E3 ubiquitin-protein ligase OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
8	A0AR23	3.95e-09	63.5	999	0.028	0.033	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
9	Q9VJ14	1.50e-07	58.5	1049	0.025	0.028	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
10	Q96AX9	1.87e-07	58.2	955	0.027	0.032	MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=4
11	Q9VUX2	1.29e-06	55.5	1226	0.035	0.033	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
12	Q8R516	1.39e-06	55.1	973	0.025	0.030	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
13	Q86YT6	2.47e-05	51.2	1006	0.030	0.035	MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1
14	Q80SY4	2.69e-05	50.8	1006	0.030	0.035	MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1
15	D3ZUV2	2.73e-05	50.8	1006	0.030	0.035	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
16	Q804S5	4.72e-05	50.1	1030	0.030	0.034	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
17	E9PZP8	0.071	40.0	4859	0.017	0.004	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
18	Q8BNF7	0.12	39.3	1203	0.017	0.017	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
19	Q15751	0.19	38.5	4861	0.016	0.004	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
20	P0DKL4	1.7	35.4	1214	0.025	0.024	S130A_ARATH Spliceosome-associated protein 130 A OS=Arabidopsis thaliana OX=3702 GN=SAP130A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06701 MIB_HERC2	1.9e-18	77.6	Mib_herc2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362578	0.974	E3 ubiquitin-protein ligase RNF8
2	9606.ENSP00000382390	0.946	Neuralized-like protein 4
3	9606.ENSP00000232165	0.913	Ubiquitin-protein ligase E3A
4	9606.ENSP00000463027	0.912	Nuclear receptor coactivator 4
5	9606.ENSP00000012443	0.910	Serine/threonine-protein phosphatase 5
6	9606.ENSP00000348056	0.901	SUMO-conjugating enzyme UBC9
7	9606.ENSP00000262971	0.895	E3 SUMO-protein ligase PIAS4
8	9606.ENSP00000418960	0.882	Breast cancer type 1 susceptibility protein
9	9606.ENSP00000313811	0.869	Ubiquitin carboxyl-terminal hydrolase 20
10	9606.ENSP00000316176	0.854	Ubiquitin-conjugating enzyme E2 N
11	9606.ENSP00000254719	0.840	Replication protein A 70 kDa DNA-binding subunit
12	9606.ENSP00000262189	0.822	Histone-lysine N-methyltransferase 2C
13	9606.ENSP00000376077	0.813	Small ubiquitin-related modifier 1
14	9606.ENSP00000320898	0.799	E3 ubiquitin-protein ligase RNF168
15	9606.ENSP00000369857	0.786	BRCA1-A complex subunit Abraxas 1
16	9606.ENSP00000304854	0.785	NudC domain-containing protein 2
17	9606.ENSP00000344866	0.780	F-box/LRR-repeat protein 5
18	9606.ENSP00000308944	0.778	Helicase-like transcription factor
19	9606.ENSP00000365588	0.775	Mediator of DNA damage checkpoint protein 1
20	9606.ENSP00000233027	0.771	Serine/threonine-protein kinase Nek4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.964	catalytic activity
GO:0016740	0.572	transferase activity
GO:0140096	0.486	catalytic activity, acting on a protein
GO:0004842	0.401	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.515	cellular process
GO:0008152	0.422	metabolic process
GO:0032501	0.348	multicellular organismal process
GO:1901564	0.336	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043226	0.997	organelle
GO:0043227	0.990	membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0005737	0.986	cytoplasm
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0005634	0.625	nucleus
GO:0005829	0.521	cytosol
GO:0071944	0.332	cell periphery
GO:0005886	0.313	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.572	Transferases.

[back to server]