StarFunc result for job id Q9BVS4

User Input

>input (552 residues)
MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHK
LIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQF
ALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPID
YNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESD
HITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEV
SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLE
ESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTR
TLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNI
KSSLEAASFWGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BVS4	1.000	1.000	8.457E-96	552	1.000	1.000	Q9BVS4.pdb.gz	RIOK2_HUMAN Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2
2	AFDB:Q95Q34	0.575	0.600	5.842E-47	529	0.377	0.393	Q95Q34.pdb.gz	RIOK2_CAEEL Serine/threonine-protein kinase RIO2 OS=Caenorhabditis elegans OX=6239 GN=riok-2 PE=2 SV=2
3	AFDB:Q9VBU2	0.555	0.569	6.433E-46	538	0.375	0.385	Q9VBU2.pdb.gz	Q9VBU2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=RIOK2 PE=3 SV=1
4	PDB:6g18v	0.475	0.793	1.293E-43	325	0.498	0.846	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
5	AFDB:Q9P7W5	0.531	0.841	2.611E-42	344	0.312	0.500	Q9P7W5.pdb.gz	RIO2_SCHPO Serine/threonine-protein kinase rio2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio2 PE=3 SV=2
6	PDB:6fail	0.455	0.842	3.378E-30	286	0.232	0.448	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
7	PDB:6zxdz	0.315	0.574	1.153E-12	292	0.101	0.192	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
8	PDB:6zxfz	0.341	0.493	8.941E-12	373	0.096	0.142	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
9	PDB:5yk1A	0.236	0.310	1.761E-7	401	0.076	0.105	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
10	AFDB:Q6ZEZ5	0.238	0.226	3.847E-7	585	0.114	0.108	Q6ZEZ5.pdb.gz	NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK3 PE=1 SV=1
11	PDB:6wqxC	0.230	0.491	6.380E-7	231	0.067	0.160	6wqxC.pdb.gz	Crystal structure of the human PRPK-TPRKB complex.
12	PDB:4bvuA	0.234	0.660	6.764E-7	171	0.063	0.205	4bvuA.pdb.gz
13	AFDB:Q21029	0.209	0.088	9.811E-7	1498	0.118	0.043	Q21029.pdb.gz	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
14	PDB:4zhxA	0.183	0.240	1.287E-6	409	0.062	0.083	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:5u6yA	0.229	0.270	1.447E-6	459	0.096	0.115	5u6yA.pdb.gz
16	PDB:6b1uA	0.197	0.241	1.829E-6	442	0.058	0.072	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	AFDB:Q6P0Q8	0.215	0.076	1.980E-6	1798	0.163	0.050	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
18	AFDB:Q57WV2	0.224	0.214	2.099E-6	583	0.132	0.125	Q57WV2.pdb.gz	Q57WV2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.890 PE=4 SV=1
19	AFDB:Q62726	0.210	0.187	1.145E-5	629	0.101	0.089	Q62726.pdb.gz	CILK1_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus OX=10116 GN=Cilk1 PE=1 SV=1
20	AFDB:F1QEF3	0.202	0.159	1.535E-5	741	0.105	0.078	F1QEF3.pdb.gz	F1QEF3_DANRE SNF-related kinase b OS=Danio rerio OX=7955 GN=snrk1 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BVS4	0.0	1155	552	1.000	1.000	RIOK2_HUMAN Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2
2	Q9VBU2	9.86e-153	450	538	0.462	0.474	Q9VBU2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=RIOK2 PE=3 SV=1
3	Q95Q34	2.47e-138	413	529	0.337	0.352	RIOK2_CAEEL Serine/threonine-protein kinase RIO2 OS=Caenorhabditis elegans OX=6239 GN=riok-2 PE=2 SV=2
4	Q9P7W5	7.50e-123	366	344	0.304	0.488	RIO2_SCHPO Serine/threonine-protein kinase rio2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio2 PE=3 SV=2
5	P40160	1.45e-94	296	425	0.299	0.388	RIO2_YEAST Serine/threonine-protein kinase RIO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO2 PE=1 SV=1
6	Q9VTL5	6.03e-13	73.9	585	0.096	0.091	Q9VTL5_DROME Serine/threonine-protein kinase RIO1 OS=Drosophila melanogaster OX=7227 GN=RIOK1 PE=2 SV=1
7	O42650	1.14e-10	66.2	497	0.094	0.105	RIO1_SCHPO Serine/threonine-protein kinase rio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio1 PE=3 SV=2
8	Q12196	3.97e-10	64.7	484	0.107	0.122	RIO1_YEAST Serine/threonine-protein kinase RIO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO1 PE=1 SV=1
9	Q9BRS2	9.05e-10	63.5	568	0.089	0.086	RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2
10	G5EAT2	6.27e-09	60.8	558	0.094	0.093	G5EAT2_EMENI Serine/threonine-protein kinase RIO1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06363 PE=3 SV=1
11	O44959	3.27e-08	58.5	506	0.091	0.099	RIOK1_CAEEL Serine/threonine-protein kinase RIO1 OS=Caenorhabditis elegans OX=6239 GN=riok-1 PE=2 SV=5
12	O14730	3.30e-05	48.9	519	0.092	0.098	RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2
13	Q6ZWH5	0.063	38.9	1172	0.076	0.036	NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens OX=9606 GN=NEK10 PE=1 SV=3
14	Q9UYB9	0.41	35.0	220	0.045	0.114	BUD32_PYRAB KEOPS complex subunit Bud32 OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=bud32 PE=1 SV=1
15	P42818	0.46	35.8	465	0.040	0.047	KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana OX=3702 GN=ATPK1 PE=1 SV=1
16	F4JY37	0.47	35.8	1366	0.029	0.012	RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana OX=3702 GN=RUK PE=1 SV=1
17	Q39030	0.53	35.4	471	0.040	0.047	KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana OX=3702 GN=ATPK2 PE=1 SV=2
18	Q5F3X1	0.56	35.4	674	0.043	0.036	Q5F3X1_CHICK Protein kinase C OS=Gallus gallus OX=9031 GN=RCJMB04_5a10 PE=2 SV=1
19	Q924I2	0.56	35.4	873	0.036	0.023	M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map4k3 PE=1 SV=2
20	Q99JP0	0.56	35.4	894	0.036	0.022	M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map4k3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.027	25.1	ABC1 atypical kinase-like domain
2	PF01636 APH	4.6e-05	34.9	Phosphotransferase enzyme family
3	PF06293 Kdo	5.4e-05	34.2	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF01163 RIO1	5.5e-52	187.6	RIO1 family
5	PF09202 Rio2_N	4.5e-29	111.9	Rio2, N-terminal
6	PF19974 TCAD9	3.3	18.3	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230340	0.999	Bystin
2	9606.ENSP00000263657	0.999	RNA-binding protein PNO1
3	9606.ENSP00000268802	0.999	RNA-binding protein NOB1
4	9606.ENSP00000301364	0.999	Pre-rRNA-processing protein TSR1 homolog
5	9606.ENSP00000356548	0.999	Protein LTV1 homolog
6	9606.ENSP00000467466	0.998	Ribosomal protein S15
7	9606.ENSP00000472985	0.997	Ribosomal protein S5
8	9606.ENSP00000385958	0.995	Ribosomal protein S14
9	9606.ENSP00000379888	0.994	Ribosomal protein S8
10	9606.ENSP00000429374	0.994	Ribosomal protein S20
11	9606.ENSP00000199320	0.993	Probable dimethyladenosine transferase
12	9606.ENSP00000435777	0.993	Ribosomal protein S13
13	9606.ENSP00000278572	0.992	40S ribosomal protein S3
14	9606.ENSP00000341874	0.992	Serine/threonine-protein kinase RIO3
15	9606.ENSP00000470972	0.992	40S ribosomal protein S19
16	9606.ENSP00000341885	0.991	Ribosomal protein S2
17	9606.ENSP00000393241	0.987	40S ribosomal protein S18
18	9606.ENSP00000472469	0.987	Ribosomal protein S28
19	9606.ENSP00000346046	0.986	Ribosomal protein S17
20	9606.ENSP00000435370	0.986	Ubiquitin-like protein FUBI

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.944	catalytic activity
GO:0016740	0.816	transferase activity
GO:0140096	0.356	catalytic activity, acting on a protein
GO:0016772	0.303	transferase activity, transferring phosphorus-containing groups

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0044238	0.996	primary metabolic process
GO:0010467	0.995	gene expression
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0042254	0.993	ribosome biogenesis
GO:0034470	0.992	ncRNA processing
GO:0050794	0.991	regulation of cellular process
GO:0006364	0.984	rRNA processing
GO:0042274	0.976	ribosomal small subunit biogenesis
GO:0048518	0.971	positive regulation of biological process
GO:0048522	0.947	positive regulation of cellular process
GO:0046822	0.946	regulation of nucleocytoplasmic transport
GO:0019538	0.897	protein metabolic process
GO:0019222	0.896	regulation of metabolic process
GO:0030490	0.894	maturation of SSU-rRNA
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0080090	0.863	regulation of primary metabolic process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0060255	0.856	regulation of macromolecule metabolic process
GO:0032388	0.836	positive regulation of intracellular transport
GO:0046824	0.833	positive regulation of nucleocytoplasmic transport
GO:0043412	0.825	macromolecule modification
GO:0010468	0.690	regulation of gene expression
GO:0009893	0.607	positive regulation of metabolic process
GO:0010604	0.575	positive regulation of macromolecule metabolic process
GO:0051726	0.370	regulation of cell cycle
GO:0019219	0.369	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0031325	0.364	positive regulation of cellular metabolic process
GO:0036211	0.353	protein modification process
GO:0051252	0.348	regulation of RNA metabolic process
GO:0006796	0.322	phosphate-containing compound metabolic process
GO:0010564	0.301	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:1990904	0.992	ribonucleoprotein complex
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0030684	0.812	preribosome
GO:0005730	0.745	nucleolus
GO:0030688	0.709	preribosome, small subunit precursor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.816	Transferases.
EC:2.7.-.-	0.303	Transferring phosphorus-containing groups.

[back to server]