StarFunc result for job id Q9BVV6

User Input

>input (1533 residues)
MPVKRLREVVSQNHGDHLVLLKDELPCVPPALSANKRLPVGTGTSLNGTSRGSSDLTSAR
NCYQPLLENPMVSESDFSKDVAVQVLPLDKIEENNKQKANDIFISQYTMGQKDALRTVLK
QKAQSMPVFKEVKVHLLEDAGIEKDAVTQETRISPSGIDSATTVAAATAAAIATAAPLIK
VQSDLEAKVNSVTELLSKLQETDKHLQRVTEQQTSIQRKQEKLHCHDHEKQMNVFMEQHI
RHLEKLQQQQIDIQTHFISAALKTSSFQPVSMPSSRAVEKYSVKPEHPNLGSCNPSLYNT
FASKQAPLKEVEDTSFDKQKSPLETPAPRRFAPVPVSRDDELSKRENLLEEKENMEVSCH
RGNVRLLEQILNNNDSLTRKSESSNTTSLTRSKIGWTPEKTNRFPSCEELETTKVTMQKS
DDVLHDLGQKEKETNSMVQPKESLSMLKLPDLPQNSVKLQTTNTTRSVLKDAEKILRGVQ
NNKKVLEENLEAIIRAKDGAAMYSLINALSTNREMSEKIRIRKTVDEWIKTISAEIQDEL
SRTDYEQKRFDQKNQRTKKGQNMTKDIRTNTQDKTVNKSVIPRKHSQKQIEEHFRNLPMR
GMPASSLQKERKEGLLKATTVIQDEDYMLQVYGKPVYQGHRSTLKKGPYLRFNSPSPKSR
PQRPKVIERVKGTKVKSIRTQTDFYATKPKKMDSKMKHSVPVLPHGDQQYLFSPSREMPT
FSGTLEGHLIPMAILLGQTQSNSDTMPPAGVIVSKPHPVTVTTSIPPSSRKVETGVKKPN
IAIVEMKSEKKDPPQLTVQVLPSVDIDSISNSSADVLSPLSSPKEASLPPVQTWIKTPEI
MKVDEEEVKFPGTNFDEIIDVIQEEEKCDEIPDSEPILEFNRSVKADSTKYNGPPFPPVA
STFQPTADILDKVIERKETLENSLIQWVEQEIMSRIISGLFPVQQQIAPSISVSVSETSE
PLTSDIVEGTSSGALQLFVDAGVPVNSNVIKHFVNEALAETIAVMLGDREAKKQGPVATG
VSGDASTNETYLPARVCTPLPTPQPTPPCSPSSPAKECVLVKTPDSSPCDSDHDMAFPVK
EICAEKGDDMPAIMLVNTPTVTPTTTPPPAAAVFTPTLSDISIDKLKVSSPELPKPWGDG
DLPLEEENPNSPQEELHPRAIVMSVAKDEEPESMDFPAQPPPPEPVPFMPFPAGTKAPSP
SQMPGSDSSTLESTLSVTVTETETLDKPISEGEILFSCGQKLAPKILEDIGLYLTNLNDS
LSSTLHDAVEMEDDPPSEGQVIRMSHKKFHADAILSFAKQNQESAVSQQAVYHSEDLENS
VGELSEGQRPQLTAAAENILMGHSLYMQPPVTNTQSLDQQCDPKPLSRQFDTVSGSIYED
SCASHGPMSLGELELEPNSKLVLPTTLLTAQENDVNLPVAAEDFSQYQLKQNQDVKQVEH
KPSQSYLRVRNKSDIAPSQQQVSPGDMDRTQIELNPYLTCVFSGGKAVPLSASQMPPAKM
SVMLPSVNLEDCSQSLSLSTMQEDMESSGADTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PV87	0.245	0.246	0.000	1520	0.697	0.703	E9PV87.pdb.gz	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1
2	AFDB:Q9BVV6	1.000	1.000	0.000	1533	1.000	1.000	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
3	AFDB:Q1G7G9	0.136	0.137	3.516E-84	1523	0.439	0.442	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
4	AFDB:H6D7E6	0.139	0.137	1.793E-52	1554	0.315	0.311	H6D7E6.pdb.gz	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1
5	AFDB:Q6P5H2	0.035	0.030	6.876E-10	1864	0.158	0.130	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
6	AFDB:F4I1T7	0.037	0.033	2.364E-8	1819	0.142	0.119	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
7	AFDB:Q70IV5	0.048	0.047	4.298E-7	1561	0.130	0.128	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
8	AFDB:P34250	0.045	0.058	1.333E-6	1132	0.109	0.148	P34250.pdb.gz	SEG2_YEAST Eisosome protein SEG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEG2 PE=1 SV=1
9	AFDB:Q6PAC4	0.041	0.044	6.321E-6	1279	0.121	0.145	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
10	AFDB:Q5U0U1	0.033	0.039	1.282E-5	1267	0.108	0.130	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
11	PDB:3jb9g	0.028	0.215	8.688	148	0.012	0.128	3jb9g.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PV87	0.0	1925	1520	0.695	0.701	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1
2	Q1G7G9	0.0	978	1523	0.429	0.431	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
3	Q9BVV6	0.0	3141	1533	1.000	1.000	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
4	H6D7E6	2.93e-124	427	1554	0.222	0.219	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01763 Herpes_UL6	4.2	17.4	Herpesvirus UL6 like
2	PF15324 TALPID3	0	2029.4	Hedgehog signalling target

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008955254.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008950295.1	0.740	Centrosomal protein 120
2	9597.XP_003819793.1	0.704	IQ motif containing E
3	9597.XP_003808742.1	0.690	GLI family zinc finger 3
4	9597.XP_008965684.1	0.677	C2 domain-containing protein 3 isoform X1
5	9597.XP_003830601.1	0.668	Centriolar coiled-coil protein 110
6	9597.XP_008955253.1	0.665	Dishevelled binding antagonist of beta catenin 1
7	9597.XP_003831398.2	0.629	Centrosome and spindle pole-associated protein 1 isoform X1
8	9597.XP_003805741.1	0.588	OFD1, centriole and centriolar satellite protein
9	9597.XP_003829836.1	0.586	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
10	9597.XP_008951950.1	0.585	Centrosomal protein of 290 kDa isoform X1
11	9597.XP_008977050.1	0.564	Spindle and centriole associated protein 1
12	9597.XP_008955289.1	0.555	F-box only protein 34
13	9597.XP_003813613.1	0.501	RAB8A, member RAS oncogene family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006996	0.986	organelle organization
GO:0050794	0.985	regulation of cellular process
GO:0070925	0.907	organelle assembly
GO:0060271	0.895	cilium assembly
GO:0032880	0.848	regulation of protein localization
GO:0070201	0.623	regulation of establishment of protein localization
GO:0051179	0.302	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0043227	0.994	membrane-bounded organelle
GO:0005929	0.969	cilium
GO:0005737	0.937	cytoplasm
GO:0036064	0.910	ciliary basal body
GO:0005829	0.780	cytosol
GO:0043231	0.415	intracellular membrane-bounded organelle
GO:0005634	0.387	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]