StarFunc result for job id Q9BVV7

User Input

>input (248 residues)
MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGV
TQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISI
TGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRF
TEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIII
EDNRSQDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BVV7	1.000	1.000	3.315E-39	248	1.000	1.000	Q9BVV7.pdb.gz	TIM21_HUMAN Mitochondrial import inner membrane translocase subunit Tim21 OS=Homo sapiens OX=9606 GN=TIMM21 PE=1 SV=1
2	AFDB:Q8CCM6	0.551	0.559	1.224E-29	244	0.685	0.697	Q8CCM6.pdb.gz	TIM21_MOUSE Mitochondrial import inner membrane translocase subunit Tim21 OS=Mus musculus OX=10090 GN=Timm21 PE=1 SV=2
3	AFDB:Q1G3L1	0.454	0.421	4.058E-13	269	0.202	0.186	Q1G3L1.pdb.gz	TIM21_ARATH Probable mitochondrial import inner membrane translocase subunit TIM21 OS=Arabidopsis thaliana OX=3702 GN=TIM21 PE=1 SV=1
4	AFDB:O94618	0.506	0.556	1.255E-10	223	0.169	0.188	O94618.pdb.gz	TIM21_SCHPO Mitochondrial import inner membrane translocase subunit tim21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim21 PE=3 SV=1
5	AFDB:Q9LXZ7	0.356	0.207	2.529E-7	434	0.194	0.111	Q9LXZ7.pdb.gz	Q9LXZ7_ARATH At3g56430 OS=Arabidopsis thaliana OX=3702 GN=ATTIM21L-2 PE=1 SV=1
6	PDB:6k7fA	0.368	0.194	1.921E-5	499	0.105	0.052	6k7fA.pdb.gz	Crystal contact-free conformation of an intrinsically flexible loop in protein crystal: Tim21 as the case study.
7	AFDB:Q86VY4	0.165	0.111	5.530E-3	417	0.113	0.067	Q86VY4.pdb.gz	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
8	AFDB:Q9UJ04	0.179	0.140	9.217E-3	414	0.109	0.065	Q9UJ04.pdb.gz	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
9	AFDB:Q8GWR0	0.188	0.168	2.420E-2	287	0.133	0.115	Q8GWR0.pdb.gz	COX11_ARATH Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX11 PE=2 SV=1
10	PDB:7odrd	0.134	0.131	4.335E-2	259	0.109	0.104	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
11	AFDB:A0A024R9L0	0.124	0.097	4.519E-2	327	0.121	0.092	A0A024R9L0.pdb.gz
12	AFDB:Q9CWX2	0.113	0.095	4.783E-2	328	0.129	0.098	Q9CWX2.pdb.gz	CIA30_MOUSE Complex I intermediate-associated protein 30, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf1 PE=1 SV=2
13	PDB:5lj5t	0.143	0.088	6.094E-2	438	0.077	0.043	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
14	PDB:1iznA	0.175	0.163	5.579E-1	275	0.036	0.033	1iznA.pdb.gz
15	PDB:1uliD	0.177	0.219	5.579E-1	178	0.040	0.056	1uliD.pdb.gz	Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
16	PDB:7apkE	0.142	0.096	6.615E-1	523	0.077	0.036	7apkE.pdb.gz
17	PDB:7ohaM	0.083	0.148	6.615E-1	107	0.052	0.121	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
18	PDB:3bxoA	0.154	0.161	7.001E-1	236	0.040	0.042	3bxoA.pdb.gz	Three-Dimensional Structure of DesVI from Streptomyces venezuelae: A Sugar N,N-Dimethyltransferase Required for dTDP-Desosamine Biosynthesis.
19	PDB:5uwaA	0.175	0.224	7.410E-1	185	0.040	0.054	5uwaA.pdb.gz	Architectures of Lipid Transport Systems for the Bacterial Outer Membrane.
20	PDB:6baqF	0.121	0.137	7.410E-1	211	0.056	0.066	6baqF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BVV7	0.0	507	248	1.000	1.000	TIM21_HUMAN Mitochondrial import inner membrane translocase subunit Tim21 OS=Homo sapiens OX=9606 GN=TIMM21 PE=1 SV=1
2	Q8CCM6	6.71e-121	346	244	0.685	0.697	TIM21_MOUSE Mitochondrial import inner membrane translocase subunit Tim21 OS=Mus musculus OX=10090 GN=Timm21 PE=1 SV=2
3	O94618	1.67e-09	58.5	223	0.190	0.211	TIM21_SCHPO Mitochondrial import inner membrane translocase subunit tim21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim21 PE=3 SV=1
4	Q1G3L1	4.12e-09	57.8	269	0.238	0.219	TIM21_ARATH Probable mitochondrial import inner membrane translocase subunit TIM21 OS=Arabidopsis thaliana OX=3702 GN=TIM21 PE=1 SV=1
5	Q5B9K7	2.7	31.6	646	0.105	0.040	Q5B9K7_EMENI Nucleoporin NUP37 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02773 PE=4 SV=1
6	Q9C5I1	7.3	30.4	614	0.065	0.026	USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=USP PE=1 SV=1
7	H3BNI3	7.8	28.5	85	0.089	0.259	H3BNI3_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
8	G5EFU0	9.7	30.0	522	0.077	0.036	PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans OX=6239 GN=pak-2 PE=2 SV=1
9	O14917	9.7	30.0	1159	0.121	0.026	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08695 Coa1	0.16	23.1	Cytochrome oxidase complex assembly protein 1
2	PF08503 DapH_N	5e+02	12.3	Tetrahydrodipicolinate succinyltransferase N-terminal
3	PF08294 TIM21	7.4e-43	157.4	TIM21

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000169551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445806	0.999	Mitochondrial import inner membrane translocase subunit TIM50
2	9606.ENSP00000356256	0.994	Mitochondrial import inner membrane translocase subunit Tim17-A
3	9606.ENSP00000464522	0.994	Mitochondrial import inner membrane translocase subunit Tim23
4	9606.ENSP00000216034	0.987	Mitochondrial import receptor subunit TOM22 homolog
5	9606.ENSP00000270538	0.985	Mitochondrial import inner membrane translocase subunit TIM44
6	9606.ENSP00000257245	0.982	Mitochondrial import inner membrane translocase subunit Tim10
7	9606.ENSP00000315693	0.965	Mitochondrial import inner membrane translocase subunit TIM16
8	9606.ENSP00000379999	0.964	Translocase of inner mitochondrial membrane 17B
9	9606.ENSP00000372005	0.963	Mitochondrial import inner membrane translocase subunit TIM14
10	9606.ENSP00000249269	0.957	Mitochondrial-processing peptidase subunit beta
11	9606.ENSP00000360782	0.956	Mitochondrial-processing peptidase subunit alpha
12	9606.ENSP00000363211	0.956	Translocase of inner mitochondrial membrane 23 homolog B
13	9606.ENSP00000370808	0.914	ADP/ATP translocase 3
14	9606.ENSP00000363191	0.911	Reactive oxygen species modulator 1
15	9606.ENSP00000297185	0.892	Stress-70 protein, mitochondrial
16	9606.ENSP00000410339	0.858	Mitochondrial import receptor subunit TOM40 homolog
17	9606.ENSP00000299166	0.847	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
18	9606.ENSP00000368523	0.824	DnaJ homolog subfamily C member 15
19	9606.ENSP00000351214	0.820	Mitochondrial import receptor subunit TOM7 homolog
20	9606.ENSP00000264954	0.818	GrpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006626	0.994	protein targeting to mitochondrion
GO:0022607	0.986	cellular component assembly
GO:0033108	0.978	mitochondrial respiratory chain complex assembly
GO:0017004	0.972	cytochrome complex assembly
GO:0010257	0.963	NADH dehydrogenase complex assembly
GO:0055085	0.957	transmembrane transport
GO:1990542	0.954	mitochondrial transmembrane transport
GO:0044743	0.952	protein transmembrane import into intracellular organelle
GO:0065002	0.952	intracellular protein transmembrane transport
GO:0032981	0.913	mitochondrial respiratory chain complex I assembly
GO:0008535	0.898	respiratory chain complex IV assembly
GO:0033617	0.841	mitochondrial cytochrome c oxidase assembly
GO:0030150	0.461	protein import into mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0098798	0.996	mitochondrial protein-containing complex
GO:0098796	0.995	membrane protein complex
GO:0098800	0.994	inner mitochondrial membrane protein complex
GO:0005744	0.919	TIM23 mitochondrial import inner membrane translocase complex
GO:0070013	0.385	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]