StarFunc result for job id Q9BW60

User Input

>input (279 residues)
MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRG
FMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFI
ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYL
YYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYG
TIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BW60	1.000	1.000	3.084E-39	279	1.000	1.000	Q9BW60.pdb.gz	ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens OX=9606 GN=ELOVL1 PE=1 SV=1
2	AFDB:A0A0R4IT00	0.949	0.828	5.096E-31	320	0.688	0.600	A0A0R4IT00.pdb.gz	A0A0R4IT00_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=wu:fj32h05 PE=3 SV=1
3	AFDB:Q5XJ87	0.927	0.822	1.657E-28	315	0.645	0.571	Q5XJ87.pdb.gz	Q5XJ87_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=zgc:103538 PE=1 SV=1
4	AFDB:A1L3X0	0.925	0.920	7.376E-26	281	0.570	0.566	A1L3X0.pdb.gz	ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1
5	PDB:6y7fB	0.907	0.988	1.437E-25	256	0.548	0.598	6y7fB.pdb.gz	Crystal structure of human ELOVL fatty acid elongase 7 (ELOVL7)
6	AFDB:Q9VHX7	0.891	0.759	1.357E-21	329	0.455	0.386	Q9VHX7.pdb.gz	ELOV7_DROME Elongation of very long chain fatty acids protein 7 OS=Drosophila melanogaster OX=7227 GN=Elovl7 PE=2 SV=2
7	AFDB:Q9VCY6	0.872	0.825	1.504E-19	295	0.434	0.410	Q9VCY6.pdb.gz	Q9VCY6_DROME Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=sit PE=2 SV=1
8	AFDB:D9IVG8	0.861	0.787	1.573E-19	306	0.430	0.392	D9IVG8.pdb.gz	D9IVG8_SALSA Elongation of very long chain fatty acids protein 4 OS=Salmo salar OX=8030 GN=elovl4 PE=2 SV=1
9	AFDB:Q9GZR5	0.850	0.758	1.646E-19	314	0.412	0.366	Q9GZR5.pdb.gz	ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens OX=9606 GN=ELOVL4 PE=1 SV=1
10	AFDB:Q6P978	0.871	0.804	2.252E-19	303	0.423	0.389	Q6P978.pdb.gz	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
11	AFDB:Q6PBM2	0.891	0.806	2.695E-19	309	0.416	0.375	Q6PBM2.pdb.gz	Q6PBM2_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=zgc:73341 PE=2 SV=1
12	PDB:5j4nA	0.161	0.115	8.109E-1	437	0.133	0.085	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
13	PDB:7cxrA	0.418	0.388	1.328	307	0.104	0.094	7cxrA.pdb.gz
14	PDB:7x1tA	0.187	0.191	1.389	272	0.104	0.107	7x1tA.pdb.gz	Structural insights into thyrotropin-releasing hormone receptor activation by an endogenous peptide agonist or its orally administered analogue.
15	PDB:5nbdA	0.189	0.109	1.519	564	0.111	0.055	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
16	PDB:7f73A	0.431	0.414	1.662	293	0.057	0.055	7f73A.pdb.gz
17	PDB:7c9iC	0.194	0.219	1.988	243	0.108	0.123	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
18	PDB:7vktA	0.137	0.133	2.175	287	0.129	0.125	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
19	PDB:5ctgB	0.136	0.158	2.275	220	0.136	0.173	5ctgB.pdb.gz
20	PDB:4aqfB	0.144	0.096	2.721	474	0.082	0.049	4aqfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BW60	0.0	573	279	1.000	1.000	ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens OX=9606 GN=ELOVL1 PE=1 SV=1
2	Q9JLJ5	0.0	543	279	0.925	0.925	ELOV1_MOUSE Elongation of very long chain fatty acids protein 1 OS=Mus musculus OX=10090 GN=Elovl1 PE=1 SV=1
3	A0A0R4IT00	1.28e-146	415	320	0.692	0.603	A0A0R4IT00_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=wu:fj32h05 PE=3 SV=1
4	Q5XJ87	3.81e-130	373	315	0.627	0.556	Q5XJ87_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=zgc:103538 PE=1 SV=1
5	A1L3X0	3.14e-117	339	281	0.570	0.566	ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1
6	Q9VHX7	9.09e-77	238	329	0.441	0.374	ELOV7_DROME Elongation of very long chain fatty acids protein 7 OS=Drosophila melanogaster OX=7227 GN=Elovl7 PE=2 SV=2
7	Q6P978	4.04e-70	220	303	0.434	0.399	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
8	Q6PBM2	4.63e-70	220	309	0.427	0.385	Q6PBM2_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=zgc:73341 PE=2 SV=1
9	D9IVG8	7.30e-69	217	306	0.419	0.382	D9IVG8_SALSA Elongation of very long chain fatty acids protein 4 OS=Salmo salar OX=8030 GN=elovl4 PE=2 SV=1
10	Q9VCY6	1.48e-67	213	295	0.409	0.386	Q9VCY6_DROME Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=sit PE=2 SV=1
11	Q9GZR5	1.09e-63	204	314	0.419	0.373	ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens OX=9606 GN=ELOVL4 PE=1 SV=1
12	Q9EQC4	1.24e-62	201	312	0.409	0.365	ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus OX=10090 GN=Elovl4 PE=1 SV=2
13	E3VVZ8	1.01e-59	193	295	0.398	0.376	E3VVZ8_CHICK Elongation of very long chain fatty acids protein 5 OS=Gallus gallus OX=9031 GN=ELOVL5 PE=1 SV=1
14	D4N2R0	1.58e-58	190	295	0.394	0.373	D4N2R0_MELGA Elongation of very long chain fatty acids protein 5 OS=Meleagris gallopavo OX=9103 GN=ELOVL5 PE=2 SV=1
15	A0A068C605	9.08e-58	188	295	0.391	0.369	A0A068C605_ANAPL Elongation of very long chain fatty acids protein 5 OS=Anas platyrhynchos OX=8839 GN=Elovl5 PE=2 SV=1
16	U3I7D9	1.14e-57	188	302	0.391	0.361	U3I7D9_ANAPP Elongation of very long chain fatty acids protein 5 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=ELOVL5 PE=3 SV=2
17	Q920L7	6.17e-53	176	299	0.369	0.344	ELOV5_RAT Elongation of very long chain fatty acids protein 5 OS=Rattus norvegicus OX=10116 GN=Elovl5 PE=1 SV=1
18	Q9NYP7	2.36e-51	172	299	0.358	0.334	ELOV5_HUMAN Elongation of very long chain fatty acids protein 5 OS=Homo sapiens OX=9606 GN=ELOVL5 PE=1 SV=1
19	B6V6V0	6.50e-51	171	294	0.366	0.347	B6V6V0_SALSA Elongation of very long chain fatty acids protein 5 OS=Salmo salar OX=8030 GN=LOC100192340 PE=2 SV=1
20	Q8AX86	3.00e-50	169	291	0.366	0.351	Q8AX86_DANRE Elongation of very long chain fatty acids protein 5 OS=Danio rerio OX=7955 GN=zgc:63549 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01151 ELO	1.1e-54	197.0	GNS1/SUR4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477602

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278353	0.974	Very-long-chain 3-oxoacyl-CoA reductase
2	9606.ENSP00000465589	0.938	Long-chain-fatty-acid--CoA ligase ACSBG2
3	9606.ENSP00000422607	0.933	Long-chain-fatty-acid--CoA ligase 1
4	9606.ENSP00000267842	0.929	Very long-chain acyl-CoA synthetase
5	9606.ENSP00000258873	0.928	Long-chain-fatty-acid--CoA ligase ACSBG1
6	9606.ENSP00000350012	0.917	Long-chain-fatty-acid--CoA ligase 3
7	9606.ENSP00000348429	0.914	Long-chain-fatty-acid--CoA ligase 5
8	9606.ENSP00000339787	0.912	Long-chain-fatty-acid--CoA ligase 4
9	9606.ENSP00000359022	0.865	Elongation of very long chain fatty acids protein 3
10	9606.ENSP00000271688	0.824	Ceramide synthase 2
11	9606.ENSP00000358831	0.823	Elongation of very long chain fatty acids protein 4
12	9606.ENSP00000424123	0.806	Elongation of very long chain fatty acids protein 7
13	9606.ENSP00000215567	0.716	Very-long-chain enoyl-CoA reductase
14	9606.ENSP00000278840	0.704	Fatty acid desaturase 2
15	9606.ENSP00000359380	0.680	Acyl-CoA desaturase
16	9606.ENSP00000284382	0.666	Ceramide synthase 3
17	9606.ENSP00000322229	0.665	Fatty acid desaturase 1
18	9606.ENSP00000363645	0.648	Acyl-CoA wax alcohol acyltransferase 1
19	9606.ENSP00000218104	0.641	ATP-binding cassette sub-family D member 1
20	9606.ENSP00000348775	0.628	Peroxisomal acyl-coenzyme A oxidase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0009922	1.000	fatty acid elongase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0044255	0.981	cellular lipid metabolic process
GO:0008610	0.981	lipid biosynthetic process
GO:0044281	0.980	small molecule metabolic process
GO:0044249	0.980	cellular biosynthetic process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0032787	0.966	monocarboxylic acid metabolic process
GO:0006631	0.934	fatty acid metabolic process
GO:1901564	0.917	organonitrogen compound metabolic process
GO:0033865	0.907	nucleoside bisphosphate metabolic process
GO:0044283	0.898	small molecule biosynthetic process
GO:0033875	0.877	ribonucleoside bisphosphate metabolic process
GO:0034032	0.877	purine nucleoside bisphosphate metabolic process
GO:0009150	0.869	purine ribonucleotide metabolic process
GO:0006637	0.863	acyl-CoA metabolic process
GO:0043604	0.841	amide biosynthetic process
GO:0006643	0.838	membrane lipid metabolic process
GO:0030148	0.818	sphingolipid biosynthetic process
GO:0072330	0.764	monocarboxylic acid biosynthetic process
GO:0090407	0.624	organophosphate biosynthetic process
GO:1901568	0.608	fatty acid derivative metabolic process
GO:0006633	0.594	fatty acid biosynthetic process
GO:0035337	0.593	fatty-acyl-CoA metabolic process
GO:0035384	0.563	thioester biosynthetic process
GO:0009165	0.510	nucleotide biosynthetic process
GO:0071616	0.458	acyl-CoA biosynthetic process
GO:0030497	0.431	fatty acid elongation
GO:0000038	0.425	very long-chain fatty acid metabolic process
GO:1901570	0.380	fatty acid derivative biosynthetic process
GO:0032502	0.346	developmental process
GO:0048856	0.336	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14993	1.000	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	1.000	fatty-acid synthase system.

[back to server]