StarFunc result for job id Q9BW61

User Input

>input (102 residues)
MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLH
QQWDKKNAAKKRDQEQVELEGESSAPPRKVARTDSPDMHEDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BW61	1.000	1.000	4.788E-16	102	1.000	1.000	Q9BW61.pdb.gz	DDA1_HUMAN DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1
2	PDB:6ud7D	0.200	0.260	1.189E-6	73	0.696	0.973	6ud7D.pdb.gz	Structural basis of indisulam-mediated RBM39 recruitment to DCAF15 E3 ligase complex.
3	PDB:6q0vE	0.197	0.295	1.147E-4	62	0.598	0.984	6q0vE.pdb.gz	Structural complementarity facilitates E7820-mediated degradation of RBM39 by DCAF15.
4	AFDB:Q14B71	0.203	0.034	7.670E-1	982	0.176	0.018	Q14B71.pdb.gz	CDCA2_MOUSE Cell division cycle-associated protein 2 OS=Mus musculus OX=10090 GN=Cdca2 PE=1 SV=2
5	AFDB:Q63180	0.180	0.037	1.913	789	0.127	0.016	Q63180.pdb.gz	ADAM7_RAT Disintegrin and metalloproteinase domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Adam7 PE=1 SV=1
6	AFDB:Q9FL63	0.200	0.049	2.719	614	0.137	0.023	Q9FL63.pdb.gz	Y5410_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100 OS=Arabidopsis thaliana OX=3702 GN=At5g24100 PE=1 SV=1
7	AFDB:P43632	0.178	0.085	3.601	304	0.216	0.072	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
8	AFDB:Q69YH5	0.200	0.033	4.447	1023	0.157	0.016	Q69YH5.pdb.gz	CDCA2_HUMAN Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2
9	AFDB:A2VEI2	0.187	0.058	4.771	525	0.147	0.029	A2VEI2.pdb.gz	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
10	AFDB:Q9BV99	0.203	0.089	5.891	259	0.137	0.054	Q9BV99.pdb.gz	LRC61_HUMAN Leucine-rich repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=LRRC61 PE=1 SV=1
11	AFDB:Q8GXC2	0.162	0.055	6.320	397	0.235	0.060	Q8GXC2.pdb.gz	PHL4_ARATH Myb family transcription factor PHL4 OS=Arabidopsis thaliana OX=3702 GN=PHL4 PE=2 SV=1
12	AFDB:Q91XX1	0.167	0.034	6.320	934	0.127	0.014	Q91XX1.pdb.gz	Q91XX1_MOUSE Protocadherin gamma C3 OS=Mus musculus OX=10090 GN=Pcdhgc3 PE=1 SV=1
13	PDB:6ke6RC	0.156	0.072	7.131	278	0.167	0.061	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
14	PDB:5dgeSM	0.215	0.148	8.805	159	0.157	0.101	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BW61	8.00e-74	215	102	1.000	1.000	DDA1_HUMAN DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1
2	Q9FFS4	3.14e-06	43.9	101	0.255	0.257	DDA1_ARATH DET1- and DDB1-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=DDA1 PE=1 SV=1
3	Q15468	1.2	30.0	1287	0.275	0.022	STIL_HUMAN SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2
4	Q9P7Y9	3.5	28.9	665	0.196	0.030	SIN1_SCHPO Target of rapamycin complex 2 subunit sin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sin1 PE=1 SV=1
5	Q9X1X1	4.2	28.5	852	0.108	0.013	RAD50_THEMA Probable DNA double-strand break repair Rad50 ATPase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=rad50 PE=1 SV=1
6	Q9VW71	5.1	28.5	4699	0.108	0.002	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
7	P34623	5.5	28.1	302	0.157	0.053	DDRGK_CAEEL DDRGK domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ufbp-1 PE=3 SV=3
8	Q7TME0	6.4	28.1	766	0.108	0.014	PLPR4_MOUSE Phospholipid phosphatase-related protein type 4 OS=Mus musculus OX=10090 GN=Plppr4 PE=1 SV=2
9	Q99JX4	9.1	27.3	374	0.225	0.061	EIF3M_MOUSE Eukaryotic translation initiation factor 3 subunit M OS=Mus musculus OX=10090 GN=Eif3m PE=1 SV=1
10	Q7L2H7	9.6	27.3	374	0.225	0.061	EIF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1
11	C9JAT7	9.8	27.3	327	0.167	0.052	C9JAT7_HUMAN UBX domain protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10172 DDA1	3.3e-27	105.7	Det1 complexing ubiquitin ligase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006057957.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006076630.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
2	89462.XP_006045054.1	0.986	Protein VPRBP isoform X1
3	89462.XP_006079956.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
4	89462.XP_006076682.1	0.982	cullin-4A
5	89462.XP_006051705.1	0.977	DDB1- and CUL4-associated factor 6 isoform X1
6	89462.XP_006055556.1	0.977	WD and tetratricopeptide repeats protein 1
7	89462.XP_006048864.1	0.976	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
8	89462.XP_006070113.1	0.972	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 24 samples with support for all annotated introns
9	89462.XP_006077768.1	0.960	DDB1- and CUL4-associated factor 11
10	89462.XP_006056222.1	0.953	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
11	89462.XP_006042479.1	0.946	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns
12	89462.XP_006060418.1	0.945	E3 ubiquitin-protein ligase RFWD2
13	89462.XP_006073146.1	0.917	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
14	89462.XP_006074653.1	0.906	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
15	89462.XP_006063539.1	0.899	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 24 samples with support for all annotated introns
16	89462.XP_006065140.1	0.899	DDB1- and CUL4-associated factor 13
17	89462.XP_006047021.1	0.893	DNA excision repair protein ERCC-8 isoform X1
18	89462.XP_006070305.1	0.889	DDB1- and CUL4-associated factor 17 isoform X1
19	89462.XP_006060549.1	0.883	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
20	89462.XP_006044185.1	0.880	DDB1- and CUL4-associated factor 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0016567	0.991	protein ubiquitination
GO:0000209	0.953	protein polyubiquitination
GO:0065007	0.604	biological regulation
GO:0050789	0.438	regulation of biological process
GO:0009987	0.412	cellular process
GO:0050794	0.381	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0080008	0.998	Cul4-RING E3 ubiquitin ligase complex
GO:0005829	0.398	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]