StarFunc result for job id Q9BW92

User Input

>input (718 residues)
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRVWEAWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UQ84	0.927	0.920	0.000	723	0.833	0.827	Q3UQ84.pdb.gz	SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Tars2 PE=1 SV=1
2	AFDB:Q9BW92	1.000	1.000	0.000	718	1.000	1.000	Q9BW92.pdb.gz	SYTM_HUMAN Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2 PE=1 SV=1
3	AFDB:A2BIM7	0.913	0.913	6.501E-101	718	0.524	0.524	A2BIM7.pdb.gz
4	AFDB:P26639	0.915	0.908	7.098E-100	723	0.522	0.519	P26639.pdb.gz	SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3
5	AFDB:Q8BLY2	0.899	0.820	1.847E-99	790	0.522	0.475	Q8BLY2.pdb.gz	SYTC2_MOUSE Threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Tars3 PE=1 SV=1
6	AFDB:A2RTX5	0.903	0.811	5.634E-99	802	0.525	0.470	A2RTX5.pdb.gz	SYTC2_HUMAN Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3 PE=1 SV=1
7	AFDB:Q8MRL7	0.909	0.874	1.205E-96	747	0.487	0.469	Q8MRL7.pdb.gz	Q8MRL7_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
8	AFDB:Q54J66	0.879	0.889	2.667E-93	710	0.465	0.470	Q54J66.pdb.gz	SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1
9	AFDB:P52709	0.894	0.886	1.904E-92	725	0.464	0.459	P52709.pdb.gz	SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=3 SV=1
10	AFDB:P87144	0.886	0.904	7.437E-91	703	0.448	0.458	P87144.pdb.gz	SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ths1 PE=3 SV=1
11	PDB:1qf6A	0.757	0.839	1.690E-70	641	0.316	0.354	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
12	PDB:3ugtC	0.517	0.854	1.388E-42	427	0.256	0.431	3ugtC.pdb.gz	Yeast mitochondrial threonyl-tRNA synthetase recognizes tRNA isoacceptors by distinct mechanisms and promotes CUN codon reassignment.
13	PDB:1nj1A	0.444	0.667	1.468E-22	463	0.111	0.173	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
14	PDB:5e6mB	0.427	0.588	3.549E-18	506	0.113	0.160	5e6mB.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
15	PDB:5e6mA	0.429	0.578	1.027E-17	519	0.106	0.146	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
16	PDB:6vlz7	0.324	0.739	1.063E-16	297	0.089	0.215	6vlz7.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
17	PDB:2zt5A	0.420	0.555	2.623E-16	530	0.109	0.147	2zt5A.pdb.gz	Crystal structures and biochemical analyses suggest unique mechanism and role for human GlyRS in Ap4A homeostasis
18	PDB:3j7y7	0.299	0.757	2.766E-16	266	0.082	0.222	3j7y7.pdb.gz	Structure of the large ribosomal subunit from human mitochondria.
19	PDB:1atiA	0.424	0.675	4.012E-16	437	0.118	0.195	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
20	PDB:1kmmC	0.365	0.610	3.020E-15	387	0.086	0.160	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2RTX5	796	802	0.522	0.468	SYTC2_HUMAN Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3 PE=1 SV=1
2	A8KC60	822	718	0.525	0.525	A8KC60_DANRE threonine--tRNA ligase OS=Danio rerio OX=7955 GN=wu:fb39c12 PE=1 SV=1
3	B2RDX5	801	711	0.521	0.526	B2RDX5_HUMAN threonine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
4	O04630	630	709	0.433	0.439	SYTM1_ARATH Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=THRRS PE=1 SV=3
5	P04801	667	734	0.451	0.441	SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THS1 PE=1 SV=2
6	P26639	800	723	0.521	0.517	SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3
7	P52709	698	725	0.464	0.459	SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=3 SV=1
8	P87144	657	703	0.451	0.461	SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ths1 PE=3 SV=1
9	Q3UQ84	1217	723	0.843	0.837	SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Tars2 PE=1 SV=1
10	Q53GX7	803	723	0.522	0.519	Q53GX7_HUMAN threonine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q54J66	698	710	0.468	0.473	SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1
12	Q57W54	551	799	0.453	0.407	Q57W54_TRYB2 threonine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.150 PE=3 SV=1
13	Q86D21	698	684	0.464	0.487	Q86D21_CAEEL threonine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=1 SV=1
14	Q8BLY2	791	790	0.515	0.468	SYTC2_MOUSE Threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Tars3 PE=1 SV=1
15	Q8IGC5	754	711	0.490	0.495	Q8IGC5_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
16	Q8IP94	754	690	0.490	0.510	Q8IP94_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=1 SV=1
17	Q8MRL7	750	747	0.489	0.470	Q8MRL7_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
18	Q9BW92	1471	718	1.000	1.000	SYTM_HUMAN Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2 PE=1 SV=1
19	Q9D0R2	803	722	0.522	0.519	SYTC_MOUSE Threonine--tRNA ligase 1, cytoplasmic OS=Mus musculus OX=10090 GN=Tars1 PE=1 SV=2
20	Q9VKB0	753	747	0.490	0.471	Q9VKB0_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	1.1e-15	68.9	Anticodon binding domain
2	PF02824 TGS	2e-07	42.3	TGS domain
3	PF00587 tRNA-synt_2b	3.9e-30	116.6	tRNA synthetase class II core domain (G, H, P, S and T)
4	PF07973 tRNA_SAD	1.1e-05	36.7	Threonyl and Alanyl tRNA synthetase second additional domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.951	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000362576	0.944	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000364794	0.939	Isoleucine--tRNA ligase, cytoplasmic
4	9606.ENSP00000262027	0.910	Methionine--tRNA ligase, cytoplasmic
5	9606.ENSP00000355889	0.907	Isoleucine--tRNA ligase, mitochondrial
6	9606.ENSP00000261772	0.904	Alanine--tRNA ligase, cytoplasmic
7	9606.ENSP00000408576	0.902	Probable leucine--tRNA ligase, mitochondrial
8	9606.ENSP00000377954	0.898	Leucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000360327	0.896	Probable proline--tRNA ligase, mitochondrial
10	9606.ENSP00000441000	0.891	Valine--tRNA ligase, mitochondrial
11	9606.ENSP00000281038	0.875	Probable asparagine--tRNA ligase, mitochondrial
12	9606.ENSP00000320658	0.867	Tyrosine--tRNA ligase, mitochondrial
13	9606.ENSP00000256854	0.864	Asparagine--tRNA ligase, cytoplasmic
14	9606.ENSP00000373918	0.863	Glycine--tRNA ligase
15	9606.ENSP00000472847	0.858	Serine--tRNA ligase, mitochondrial
16	9606.ENSP00000338093	0.856	Probable threonine--tRNA ligase 2, cytoplasmic
17	9606.ENSP00000234677	0.853	Serine--tRNA ligase, cytoplasmic
18	9606.ENSP00000369897	0.849	Cysteine--tRNA ligase, cytoplasmic
19	9606.ENSP00000325448	0.845	Lysine--tRNA ligase
20	9606.ENSP00000235521	0.838	Tryptophan--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0046983	0.999	protein dimerization activity
GO:0016787	0.998	hydrolase activity
GO:0002161	0.994	aminoacyl-tRNA editing activity
GO:0042802	0.993	identical protein binding
GO:0004829	0.871	threonine-tRNA ligase activity
GO:0042803	0.854	protein homodimerization activity
GO:1901363	0.475	heterocyclic compound binding
GO:0097159	0.475	organic cyclic compound binding
GO:0003676	0.349	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0006418	0.990	tRNA aminoacylation for protein translation
GO:0140053	0.734	mitochondrial gene expression
GO:0032543	0.717	mitochondrial translation
GO:0000959	0.639	mitochondrial RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.994	mitochondrion
GO:0043233	0.576	organelle lumen
GO:0070013	0.547	intracellular organelle lumen
GO:0005829	0.366	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
EC:3.-.-.-	0.998	Hydrolases.
EC:3.1.1.-	0.994	Carboxylic ester hydrolases.
RHEA:24624	0.871	ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + H(+) + L-threonyl-tRNA(Thr)
EC:6.1.1.3	0.871	threonine--tRNA ligase.

[back to server]