StarFunc result for job id Q9BWD1

User Input

>input (397 residues)
MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHV
LAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGME
NMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDK
VAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLT
DGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEPSIMGIGPIPA
IKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASGC
RILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWD1	1.000	1.000	1.264E-93	397	1.000	1.000	Q9BWD1.pdb.gz	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2
2	PDB:1wl4A	0.988	0.996	4.758E-86	394	0.992	1.000	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
3	AFDB:Q5XI22	0.996	0.996	9.277E-85	397	0.872	0.872	Q5XI22.pdb.gz	THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Acat2 PE=1 SV=1
4	AFDB:P76461	0.975	0.982	2.932E-63	394	0.526	0.530	P76461.pdb.gz	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
5	AFDB:Q46939	0.970	0.980	1.104E-60	393	0.476	0.481	Q46939.pdb.gz	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
6	PDB:4wysA	0.973	0.976	1.880E-59	396	0.531	0.533	4wysA.pdb.gz
7	AFDB:Q86AD9	0.966	0.927	5.083E-56	414	0.441	0.423	Q86AD9.pdb.gz	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
8	AFDB:Q9UQW6	0.960	0.965	7.868E-56	395	0.436	0.438	Q9UQW6.pdb.gz	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
9	AFDB:Q8S4Y1	0.958	0.944	1.564E-55	403	0.466	0.459	Q8S4Y1.pdb.gz	ACCT2_ARATH Acetyl-CoA acetyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=ACCT2 PE=1 SV=1
10	PDB:5f38A	0.913	0.976	4.973E-54	371	0.506	0.542	5f38A.pdb.gz	Crystal structure of a thiolase from Escherichia coli at 1.8 angstrom resolution.
11	AFDB:O51136	0.950	0.947	6.619E-54	398	0.375	0.374	O51136.pdb.gz	O51136_BORBU Acetyl-CoA acetyltransferases subfamily OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0109 PE=3 SV=1
12	AFDB:P41338	0.960	0.958	3.571E-53	398	0.416	0.415	P41338.pdb.gz	ERG10_YEAST Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG10 PE=1 SV=3
13	AFDB:P42765	0.956	0.956	4.307E-53	397	0.411	0.411	P42765.pdb.gz	THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2
14	PDB:5xyjA	0.960	0.962	4.740E-52	396	0.408	0.409	5xyjA.pdb.gz
15	PDB:2ib8D	0.956	0.965	5.758E-51	393	0.428	0.433	2ib8D.pdb.gz	Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
16	PDB:4c2kD	0.954	0.949	4.809E-50	399	0.421	0.419	4c2kD.pdb.gz
17	PDB:2iikB	0.874	0.868	3.221E-45	400	0.413	0.410	2iikB.pdb.gz
18	PDB:2wu9A	0.875	0.863	8.217E-45	403	0.388	0.382	2wu9A.pdb.gz
19	PDB:2d3tC	0.889	0.904	4.719E-44	390	0.373	0.379	2d3tC.pdb.gz	Ligand-Induced Domain Rearrangement of Fatty Acid beta-Oxidation Multienzyme Complex
20	PDB:4b3iD	0.866	0.853	2.409E-42	403	0.373	0.367	4b3iD.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XI22	0.0	700	397	0.872	0.872	THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus OX=10116 GN=Acat2 PE=1 SV=1
2	Q80X81	0.0	711	397	0.859	0.859	Q80X81_MOUSE Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus OX=10090 GN=Acat3 PE=1 SV=1
3	Q8CAY6	0.0	705	397	0.877	0.877	THIC_MOUSE Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus OX=10090 GN=Acat2 PE=1 SV=2
4	Q8R4V3	0.0	707	397	0.854	0.854	Q8R4V3_MOUSE Acetyl CoA transferase-like protein OS=Mus musculus OX=10090 GN=Acat3 PE=2 SV=1
5	Q9BWD1	0.0	805	397	1.000	1.000	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2
6	P76461	1.26e-133	390	394	0.531	0.536	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
7	Q46939	4.23e-126	371	393	0.479	0.483	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
8	Q86AD9	8.10e-106	320	414	0.441	0.423	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
9	Q7ZVG1	1.87e-104	316	397	0.446	0.446	Q7ZVG1_DANRE 3-ketoacyl-CoA thiolase, mitochondrial OS=Danio rerio OX=7955 GN=zgc:56036 PE=1 SV=1
10	Q9UQW6	4.52e-104	315	395	0.436	0.438	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
11	Q8S4Y1	1.37e-99	303	403	0.446	0.439	ACCT2_ARATH Acetyl-CoA acetyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=ACCT2 PE=1 SV=1
12	A0A140VJX1	1.16e-98	302	427	0.428	0.398	A0A140VJX1_HUMAN Testicular tissue protein Li 198 OS=Homo sapiens OX=9606 PE=2 SV=1
13	P24752	1.16e-98	302	427	0.428	0.398	THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
14	A0A0B4J2A4	8.39e-98	298	394	0.423	0.426	A0A0B4J2A4_HUMAN Acetyl-CoA acyltransferase 2 OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=1
15	P42765	1.18e-97	298	397	0.423	0.423	THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2
16	Q8BWT1	2.96e-97	297	397	0.408	0.408	THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus OX=10090 GN=Acaa2 PE=1 SV=3
17	Q9FIK7	1.30e-96	296	415	0.438	0.419	AACT1_ARATH Acetyl-CoA acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=ACCT1 PE=1 SV=1
18	P13437	2.78e-96	295	397	0.406	0.406	THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acaa2 PE=1 SV=1
19	A0A5F9ZHL1	1.19e-95	294	434	0.428	0.392	A0A5F9ZHL1_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
20	P17764	3.93e-95	293	424	0.426	0.399	THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08541 ACP_syn_III_C	2.8	19.5	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal
2	PF07311 Dodecin	70	15.1	Dodecin
3	PF00109 ketoacyl-synt	0.58	21.3	Beta-ketoacyl synthase, N-terminal domain
4	PF02803 Thiolase_C	5.6e-47	169.8	Thiolase, C-terminal domain
5	PF00108 Thiolase_N	9.7e-91	315.3	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322706	0.988	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
2	9606.ENSP00000358414	0.978	Hydroxymethylglutaryl-CoA synthase, mitochondrial
3	9606.ENSP00000370023	0.970	Trifunctional enzyme subunit alpha, mitochondrial
4	9606.ENSP00000231887	0.969	Peroxisomal bifunctional enzyme
5	9606.ENSP00000242592	0.966	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000357873	0.965	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
7	9606.ENSP00000196371	0.959	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
8	9606.ENSP00000280346	0.955	Dihydrolipoamide S-acetyltransferase
9	9606.ENSP00000361914	0.949	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
10	9606.ENSP00000293217	0.946	Peroxisomal acyl-coenzyme A oxidase 1
11	9606.ENSP00000253382	0.945	Acetyl-coenzyme A synthetase, cytoplasmic
12	9606.ENSP00000381654	0.942	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
13	9606.ENSP00000348775	0.941	Peroxisomal acyl-coenzyme A oxidase 3
14	9606.ENSP00000363614	0.940	Hydroxymethylglutaryl-CoA lyase, mitochondrial
15	9606.ENSP00000324842	0.938	Acetoacetyl-CoA synthetase
16	9606.ENSP00000316924	0.932	Acetyl-coenzyme A synthetase 2-like, mitochondrial
17	9606.ENSP00000483300	0.929	Acetyl-CoA carboxylase 1
18	9606.ENSP00000342056	0.927	Citrate synthase, mitochondrial
19	9606.ENSP00000325136	0.924	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
20	9606.ENSP00000450436	0.924	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003988	1.000	acetyl-CoA C-acyltransferase activity
GO:0016453	1.000	C-acetyltransferase activity
GO:0005515	0.999	protein binding
GO:0003985	0.962	acetyl-CoA C-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006629	0.988	lipid metabolic process
GO:0009987	0.912	cellular process
GO:0044281	0.824	small molecule metabolic process
GO:0044237	0.777	cellular metabolic process
GO:0009058	0.497	biosynthetic process
GO:1901576	0.487	organic substance biosynthetic process
GO:0008610	0.374	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005829	0.932	cytosol
GO:0005576	0.805	extracellular region
GO:0031982	0.748	vesicle
GO:0070062	0.735	extracellular exosome
GO:0005739	0.363	mitochondrion
GO:0043233	0.349	organelle lumen
GO:0070013	0.342	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21564	1.000	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	1.000	acetyl-CoA C-acyltransferase.
RHEA:21036	0.962	2 acetyl-CoA = acetoacetyl-CoA + CoA
EC:2.3.1.9	0.962	acetyl-CoA C-acetyltransferase.

[back to server]