StarFunc result for job id Q9BWF3

User Input

>input (364 residues)
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRS
GRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAAS
VYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS
TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRAR
YSAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWF3	1.000	1.000	8.338E-65	364	1.000	1.000	Q9BWF3.pdb.gz	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
2	AFDB:Q8VE92	0.495	0.504	4.472E-55	357	0.879	0.896	Q8VE92.pdb.gz	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
3	AFDB:Q803F7	0.377	0.359	1.022E-32	385	0.464	0.439	Q803F7.pdb.gz	Q803F7_DANRE RNA binding motif protein 4 like OS=Danio rerio OX=7955 GN=rbm4l PE=1 SV=1
4	AFDB:Q94901	0.330	0.340	6.015E-28	352	0.316	0.327	Q94901.pdb.gz	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1
5	AFDB:F6NL73	0.215	0.167	4.297E-22	484	0.264	0.198	F6NL73.pdb.gz
6	AFDB:A0A0S2Z4Z0	0.217	0.121	1.603E-20	669	0.266	0.145	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
7	AFDB:Q08170	0.193	0.146	1.069E-15	494	0.192	0.142	Q08170.pdb.gz	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
8	AFDB:A0A0B4KHI4	0.204	0.102	1.290E-15	761	0.228	0.109	A0A0B4KHI4.pdb.gz	A0A0B4KHI4_DROME Syncrip, isoform Q OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
9	AFDB:Q99383	0.210	0.153	2.124E-15	534	0.176	0.120	Q99383.pdb.gz	HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRP1 PE=1 SV=1
10	AFDB:Q01560	0.235	0.215	4.492E-15	414	0.162	0.143	Q01560.pdb.gz	NOP3_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPL3 PE=1 SV=1
11	PDB:7oqcF	0.202	0.271	5.001E-12	267	0.113	0.154	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:5lsbA	0.200	0.391	1.058E-11	176	0.096	0.199	5lsbA.pdb.gz
13	PDB:6y53o	0.186	0.416	2.101E-11	160	0.099	0.225	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6y5qq	0.204	0.388	1.366E-10	178	0.085	0.174	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:7evoD	0.203	0.352	1.006E-9	200	0.091	0.165	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:5vsuA	0.197	0.186	1.213E-9	387	0.080	0.075	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
17	PDB:6ff7X	0.186	0.389	6.186E-8	171	0.082	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:6r5kH	0.197	0.185	1.392E-7	394	0.104	0.096	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:5xjcw	0.195	0.758	3.357E-6	91	0.052	0.209	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:7dvqY	0.192	0.489	4.048E-6	140	0.063	0.164	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C7Q4	0.0	718	361	0.962	0.970	RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus OX=10090 GN=Rbm4 PE=1 SV=1
2	Q8VE92	0.0	604	357	0.849	0.866	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
3	Q9BQ04	0.0	619	359	0.879	0.891	RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1
4	Q9BWF3	0.0	755	364	1.000	1.000	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
5	F1Q7F8	9.52e-90	276	384	0.341	0.323	F1Q7F8_DANRE RNA binding motif protein 4 like isoform X1 OS=Danio rerio OX=7955 GN=Rbm4 PE=1 SV=1
6	Q803F7	1.02e-89	276	385	0.341	0.322	Q803F7_DANRE RNA binding motif protein 4 like OS=Danio rerio OX=7955 GN=rbm4l PE=1 SV=1
7	Q94901	4.60e-59	196	352	0.242	0.250	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1
8	Q6NV05	2.17e-49	176	556	0.225	0.147	Q6NV05_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:85696 PE=1 SV=1
9	A0A0R4IJ04	2.29e-49	176	556	0.225	0.147	A0A0R4IJ04_DANRE RNA binding motif protein 14 isoform X3 OS=Danio rerio OX=7955 GN=rbm14 PE=1 SV=2
10	A0A0S2Z4Z0	5.94e-41	154	669	0.198	0.108	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
11	Q96PK6	5.94e-41	154	669	0.198	0.108	RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2
12	Q8C2Q3	3.58e-40	152	669	0.195	0.106	RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus OX=10090 GN=Rbm14 PE=1 SV=1
13	Q503D7	5.55e-39	146	471	0.201	0.155	Q503D7_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:110682 PE=1 SV=1
14	Q10667	9.93e-18	84.7	305	0.110	0.131	RNP1_CAEEL RNA-binding protein rnp-1 OS=Caenorhabditis elegans OX=6239 GN=rnp-1 PE=2 SV=1
15	P92964	1.57e-16	80.9	264	0.124	0.170	SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana OX=3702 GN=RS31 PE=1 SV=2
16	P92965	8.28e-16	79.7	350	0.135	0.140	RS40_ARATH Serine/arginine-rich splicing factor RS40 OS=Arabidopsis thaliana OX=3702 GN=RS40 PE=1 SV=2
17	Q5PPI1	4.82e-15	75.5	221	0.151	0.249	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1
18	P92966	7.24e-15	77.0	356	0.135	0.138	SRS41_ARATH Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
19	P04147	1.68e-14	77.0	577	0.126	0.080	PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAB1 PE=1 SV=4
20	Q8CIN6	3.27e-14	75.9	465	0.228	0.178	CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus OX=10090 GN=Celf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04847 Calcipressin	5.5	18.2	Calcipressin
2	PF11546 CompInhib_SCIN	1.6e+02	13.8	Staphylococcal complement inhibitor SCIN
3	PF03880 DbpA	28	16.1	DbpA RNA binding domain
4	PF11679 DUF3275	4.7e+02	12.1	Protein of unknown function (DUF3275)
5	PF08675 RNA_bind	1.5e+02	13.8	RNA binding domain
6	PF00076 RRM_1	4.1e-31	117.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF13893 RRM_5	0.00061	30.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
8	PF16367 RRM_7	0.02	26.3	RNA recognition motif
9	PF16842 RRM_occluded	0.025	25.8	Occluded RNA-recognition motif
10	PF00098 zf-CCHC	0.00036	31.7	Zinc knuckle
11	PF13696 zf-CCHC_2	1.2e+02	13.9	Zinc knuckle
12	PF13917 zf-CCHC_3	5.9	18.2	Zinc knuckle
13	PF14787 zf-CCHC_5	1.1e+02	14.0	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007534

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017419	0.705	Eukaryotic translation initiation factor 4E family member 2
2	61853.ENSNLEP00000020542	0.696	Endothelial PAS domain protein 1
3	61853.ENSNLEP00000001761	0.664	Protein argonaute-2
4	61853.ENSNLEP00000005437	0.637	HAUS augmin-like complex, subunit 2
5	61853.ENSNLEP00000014759	0.637	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
6	61853.ENSNLEP00000013738	0.632	Polypyrimidine tract binding protein 2
7	61853.ENSNLEP00000012055	0.607	Period circadian clock 1
8	61853.ENSNLEP00000012869	0.582	Necessary for the splicing of pre-mRNA.
9	61853.ENSNLEP00000008601	0.569	RNA binding motif protein 38
10	61853.ENSNLEP00000024421	0.539	Exportin 1
11	61853.ENSNLEP00000019824	0.535	Heterogeneous nuclear ribonucleoprotein L-like
12	61853.ENSNLEP00000003605	0.534	RNA binding motif protein, X-linked
13	61853.ENSNLEP00000004743	0.524	WD repeat and FYVE domain containing 2
14	61853.ENSNLEP00000010811	0.524	Uncharacterized protein
15	61853.ENSNLEP00000020254	0.522	Remodeling and spacing factor 1
16	61853.ENSNLEP00000018176	0.506	DEAD (Asp-Glu-Ala-Asp) box helicase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0036002	0.998	pre-mRNA binding
GO:0035198	0.888	miRNA binding
GO:0097157	0.884	pre-mRNA intronic binding
GO:0030332	0.877	cyclin binding
GO:0097158	0.519	pre-mRNA intronic pyrimidine-rich binding
GO:0003730	0.409	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.991	regulation of gene expression
GO:0031323	0.985	regulation of cellular metabolic process
GO:0009987	0.982	cellular process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0050896	0.908	response to stimulus
GO:0051252	0.907	regulation of RNA metabolic process
GO:0006417	0.901	regulation of translation
GO:0048518	0.898	positive regulation of biological process
GO:0071704	0.855	organic substance metabolic process
GO:0006807	0.827	nitrogen compound metabolic process
GO:0044238	0.823	primary metabolic process
GO:0043170	0.822	macromolecule metabolic process
GO:0044237	0.818	cellular metabolic process
GO:1903311	0.779	regulation of mRNA metabolic process
GO:0043484	0.774	regulation of RNA splicing
GO:0034641	0.773	cellular nitrogen compound metabolic process
GO:0090304	0.719	nucleic acid metabolic process
GO:0010467	0.673	gene expression
GO:0016070	0.670	RNA metabolic process
GO:0006396	0.634	RNA processing
GO:0048522	0.573	positive regulation of cellular process
GO:0048519	0.552	negative regulation of biological process
GO:0048024	0.542	regulation of mRNA splicing, via spliceosome
GO:0010605	0.520	negative regulation of macromolecule metabolic process
GO:0048523	0.476	negative regulation of cellular process
GO:0031324	0.451	negative regulation of cellular metabolic process
GO:0051172	0.418	negative regulation of nitrogen compound metabolic process
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0016071	0.353	mRNA metabolic process
GO:0006397	0.328	mRNA processing
GO:0051716	0.300	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.992	cytosol
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0032991	0.964	protein-containing complex
GO:0016604	0.752	nuclear body
GO:0016607	0.672	nuclear speck
GO:0005730	0.595	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]