StarFunc result for job id Q9BWK5

User Input

>input (157 residues)
METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAE
IVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAP
GLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWK5	1.000	1.000	1.078E-22	157	1.000	1.000	Q9BWK5.pdb.gz	CYREN_HUMAN Cell cycle regulator of non-homologous end joining OS=Homo sapiens OX=9606 GN=CYREN PE=1 SV=2
2	AFDB:Q6R2K1	0.150	0.052	6.740E-1	699	0.146	0.033	Q6R2K1.pdb.gz	SRF5_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana OX=3702 GN=SRF5 PE=1 SV=1
3	PDB:7mq9SI	0.175	0.039	8.850E-1	844	0.108	0.020	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	AFDB:F1N9F2	0.137	0.065	1.033	435	0.153	0.055	F1N9F2.pdb.gz
5	AFDB:Q9VT83	0.170	0.072	1.033	408	0.102	0.039	Q9VT83.pdb.gz	Q9VT83_DROME Defective proboscis extension response 10, isoform A OS=Drosophila melanogaster OX=7227 GN=dpr10 PE=1 SV=2
6	AFDB:Q96JC9	0.206	0.131	2.257	268	0.159	0.093	Q96JC9.pdb.gz	EAF1_HUMAN ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1 PE=1 SV=1
7	AFDB:Q9V3Q6	0.143	0.046	2.793	678	0.185	0.043	Q9V3Q6.pdb.gz	M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster OX=7227 GN=Tak1 PE=2 SV=1
8	PDB:7ajtCL	0.149	0.036	2.963	781	0.089	0.018	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
9	AFDB:A1L4K1	0.127	0.040	2.999	749	0.121	0.025	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
10	PDB:7odrd	0.129	0.089	3.182	259	0.083	0.050	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
11	PDB:7d63RJ	0.149	0.036	3.416	796	0.089	0.018	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
12	AFDB:Q5TJ65	0.153	0.073	3.457	380	0.172	0.071	Q5TJ65.pdb.gz	VASP_DICDI Protein VASP homolog OS=Dictyostelium discoideum OX=44689 GN=vasp PE=1 SV=1
13	AFDB:Q8BX90	0.133	0.028	3.457	1198	0.146	0.019	Q8BX90.pdb.gz	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
14	PDB:7mqaSI	0.168	0.040	3.938	803	0.108	0.021	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	AFDB:Q9VYJ6	0.156	0.086	3.986	359	0.166	0.072	Q9VYJ6.pdb.gz	Q9VYJ6_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4004 PE=1 SV=3
16	PDB:5mrcQ	0.146	0.083	7.466	284	0.102	0.056	5mrcQ.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:7w59R	0.148	0.094	9.922	280	0.153	0.086	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BWK5	9.91e-113	318	157	1.000	1.000	CYREN_HUMAN Cell cycle regulator of non-homologous end joining OS=Homo sapiens OX=9606 GN=CYREN PE=1 SV=2
2	Q8BHZ5	8.22e-40	133	157	0.624	0.624	CYREN_MOUSE Cell cycle regulator of non-homologous end joining OS=Mus musculus OX=10090 GN=Cyren PE=1 SV=1
3	A0A2R8YCS7	0.70	32.3	589	0.159	0.042	A0A2R8YCS7_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=1
4	Q9Y3Z3	0.84	32.0	626	0.159	0.040	SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2
5	Q9V3W9	1.1	31.6	414	0.166	0.063	Q9V3W9_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=1 SV=1
6	Q9XZE0	1.2	31.6	414	0.166	0.063	Q9XZE0_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=3 SV=1
7	P28584	5.0	29.6	889	0.115	0.020	TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRK2 PE=1 SV=1
8	Q8IMB7	7.3	28.9	343	0.102	0.047	Q8IMB7_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=1 SV=1
9	L0T905	7.6	28.5	154	0.070	0.071	RSEA_MYCTU Anti-sigma-E factor RseA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rseA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15325 MRI	3.5e-47	171.0	Modulator of retrovirus infection

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000040663	0.873	Methylthioribose-1-phosphate isomerase
2	9606.ENSP00000349493	0.764	Guanylin
3	9606.ENSP00000264399	0.728	cGMP-dependent protein kinase 2
4	9606.ENSP00000327368	0.642	Collagen alpha-1(X) chain
5	9606.ENSP00000375978	0.641	X-ray repair cross-complementing protein 5
6	9606.ENSP00000288985	0.616	DNA excision repair protein ERCC-6-like 2
7	9606.ENSP00000358857	0.608	Emerin
8	9606.ENSP00000443113	0.607	Zinc finger CCHC-type containing 7
9	9606.ENSP00000485075	0.601	May possess a function in tumorigenesis
10	9606.ENSP00000360682	0.511	Protein PAXX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050896	0.988	response to stimulus
GO:0071704	0.977	organic substance metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0044238	0.971	primary metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0051716	0.964	cellular response to stimulus
GO:0048523	0.960	negative regulation of cellular process
GO:0048583	0.950	regulation of response to stimulus
GO:0043170	0.916	macromolecule metabolic process
GO:0006950	0.915	response to stress
GO:0045934	0.914	negative regulation of nucleobase-containing compound metabolic process
GO:0006303	0.906	double-strand break repair via nonhomologous end joining
GO:0010605	0.904	negative regulation of macromolecule metabolic process
GO:0051053	0.844	negative regulation of DNA metabolic process
GO:0006282	0.805	regulation of DNA repair
GO:2001021	0.745	negative regulation of response to DNA damage stimulus
GO:2000779	0.745	regulation of double-strand break repair
GO:0032501	0.333	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.943	intracellular organelle lumen
GO:0005829	0.906	cytosol
GO:0031981	0.861	nuclear lumen
GO:0043232	0.820	intracellular non-membrane-bounded organelle
GO:0005654	0.486	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]