StarFunc result for job id Q9BWS9

User Input

>input (393 residues)
MRTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESV
VLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREM
FEVTGLHDVDQGWMRAVRKHAKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQV
AKNQHFDGFVVEVWNQLLSQKRVGLIHMLTHLAEALHQARLLALLVIPPAITPGTDQLGM
FTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRACVQVLDPKSKWRSKILLGLN
FYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRSGRHVVFYPTL
KSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWS9	1.000	1.000	9.702E-85	393	1.000	1.000	Q9BWS9.pdb.gz	CHID1_HUMAN Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
2	AFDB:Q9VLS0	0.863	0.844	2.401E-43	402	0.397	0.388	Q9VLS0.pdb.gz	Q9VLS0_DROME LD18607p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8460 PE=1 SV=1
3	AFDB:Q9M159	0.825	0.756	9.010E-39	430	0.336	0.307	Q9M159.pdb.gz	Q9M159_ARATH Glycosyl hydrolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F2N1.39-01 PE=1 SV=1
4	AFDB:Q01460	0.572	0.610	1.138E-16	367	0.160	0.172	Q01460.pdb.gz	DIAC_RAT Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
5	AFDB:Q9W2M5	0.611	0.650	1.205E-16	368	0.142	0.152	Q9W2M5.pdb.gz	Q9W2M5_DROME Chitinase 9 OS=Drosophila melanogaster OX=7227 GN=Cht9 PE=3 SV=3
6	AFDB:Q9W2M7	0.607	0.509	1.205E-16	476	0.153	0.126	Q9W2M7.pdb.gz	Q9W2M7_DROME Chitinase 8 OS=Drosophila melanogaster OX=7227 GN=Cht8 PE=3 SV=2
7	AFDB:Q9W092	0.623	0.515	1.799E-16	484	0.155	0.126	Q9W092.pdb.gz	CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
8	AFDB:Q01459	0.622	0.634	6.337E-16	385	0.160	0.164	Q01459.pdb.gz	DIAC_HUMAN Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
9	AFDB:Q9VZV2	0.621	0.256	6.337E-16	1013	0.178	0.069	Q9VZV2.pdb.gz	Q9VZV2_DROME Chitinase 7 OS=Drosophila melanogaster OX=7227 GN=Cht7 PE=2 SV=3
10	AFDB:Q9W2M6	0.632	0.543	7.968E-16	462	0.130	0.110	Q9W2M6.pdb.gz	Q9W2M6_DROME Chitinase 4 OS=Drosophila melanogaster OX=7227 GN=Cht4 PE=2 SV=2
11	PDB:3aquA	0.646	0.730	1.618E-15	344	0.135	0.154	3aquA.pdb.gz
12	PDB:4p8uA	0.646	0.692	4.800E-15	365	0.148	0.159	4p8uA.pdb.gz
13	PDB:1wawA	0.640	0.686	2.525E-14	365	0.153	0.164	1wawA.pdb.gz	Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
14	PDB:1vf8A	0.628	0.659	2.493E-13	373	0.135	0.142	1vf8A.pdb.gz
15	PDB:1hjvA	0.598	0.643	4.362E-12	362	0.112	0.122	1hjvA.pdb.gz
16	PDB:1jndA	0.587	0.578	4.362E-12	400	0.120	0.117	1jndA.pdb.gz
17	PDB:6mdsA	0.381	0.206	3.815E-6	787	0.069	0.034	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
18	PDB:6peyB	0.376	0.479	2.523E-5	290	0.115	0.155	6peyB.pdb.gz	Examination of Asp120Ala a Chemically Important Novel Mutation in the Enzyme Mthylenetetrahydrofolate Reductase
19	PDB:5wrpC	0.357	0.368	2.995E-5	378	0.074	0.077	5wrpC.pdb.gz	Allosteric pyruvate kinase-based "logic gate" synergistically senses energy and sugar levels in Mycobacterium tuberculosis.
20	PDB:1dosA	0.311	0.334	1.055E-4	358	0.071	0.078	1dosA.pdb.gz	Novel active site in Escherichia coli fructose 1,6-bisphosphate aldolase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BWS9	0.0	812	393	1.000	1.000	CHID1_HUMAN Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1 PE=1 SV=1
2	Q9VLS0	1.01e-90	280	402	0.399	0.391	Q9VLS0_DROME LD18607p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8460 PE=1 SV=1
3	Q9M159	2.81e-77	247	430	0.354	0.323	Q9M159_ARATH Glycosyl hydrolase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F2N1.39-01 PE=1 SV=1
4	E9QRF2	5.97e-04	44.3	433	0.153	0.139	CHIB1_ASPFU Endochitinase B1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=chiB1 PE=3 SV=1
5	Q01460	0.010	40.0	367	0.135	0.144	DIAC_RAT Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
6	Q9W2M5	0.016	39.7	368	0.125	0.133	Q9W2M5_DROME Chitinase 9 OS=Drosophila melanogaster OX=7227 GN=Cht9 PE=3 SV=3
7	Q7YXW0	0.017	39.3	366	0.125	0.134	Q7YXW0_DROME LP07267p1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Cht9 PE=2 SV=2
8	A8JUP3	0.048	38.5	2225	0.104	0.018	A8JUP3_DROME Chitinase 6, isoform H OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=2
9	M9NF05	0.048	38.5	2574	0.104	0.016	M9NF05_DROME Chitinase 6, isoform I OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
10	Q9W2Z3	0.056	38.5	4519	0.104	0.009	Q9W2Z3_DROME Chitinase 6, isoform J OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=3
11	M9NEC2	0.062	38.1	1580	0.104	0.026	M9NEC2_DROME Chitinase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
12	M9NG70	0.066	38.1	1367	0.104	0.030	M9NG70_DROME Chitinase 6, isoform F OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=3 SV=1
13	M9NDS9	0.070	38.1	4611	0.104	0.009	M9NDS9_DROME Chitinase 6, isoform C OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
14	M9NGY0	0.071	38.1	3703	0.104	0.011	M9NGY0_DROME Chitinase 6, isoform K OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
15	A0A0W0FPC8	0.30	35.4	406	0.168	0.163	A0A0W0FPC8_9AGAR Chitinase-like effector OS=Moniliophthora roreri OX=221103 GN=Chi PE=4 SV=1
16	Q01459	1.2	33.5	385	0.122	0.125	DIAC_HUMAN Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
17	Q15782	1.8	33.1	390	0.137	0.138	CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens OX=9606 GN=CHI3L2 PE=1 SV=1
18	B9WZX0	3.5	32.3	2211	0.041	0.007	FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Aspergillus fumigatus OX=746128 GN=NRPS13 PE=1 SV=1
19	Q4WAW3	3.5	32.3	2211	0.041	0.007	FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=NRPS13 PE=1 SV=1
20	Q9P6J6	4.8	32.0	832	0.059	0.028	BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00704 Glyco_hydro_18	4.9e-16	71.0	Glycosyl hydrolases family 18
2	PF03644 Glyco_hydro_85	16	16.4	Glycosyl hydrolase family 85

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000010570

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000016831	0.700	Stabilin 1
2	9593.ENSGGOP00000006839	0.691	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin- coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
3	9593.ENSGGOP00000024746	0.687	Belongs to the glycosyl hydrolase 18 family.
4	9593.ENSGGOP00000021558	0.670	Prosaposin: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling
5	9593.ENSGGOP00000010909	0.605	Chitinase 1 (chitotriosidase)
6	9593.ENSGGOP00000005804	0.563	Creatine kinase, mitochondrial 2 (sarcomeric)
7	9593.ENSGGOP00000004558	0.559	Uncharacterized protein
8	9593.ENSGGOP00000016585	0.529	RAB29, member RAS oncogene family
9	9593.ENSGGOP00000005349	0.525	TBC1 domain family, member 8 (with GRAM domain)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070492	1.000	oligosaccharide binding
GO:0003824	0.891	catalytic activity
GO:0016787	0.772	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051241	0.988	negative regulation of multicellular organismal process
GO:0001817	0.986	regulation of cytokine production
GO:0001818	0.965	negative regulation of cytokine production
GO:1900015	0.952	regulation of cytokine production involved in inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0005576	0.995	extracellular region
GO:0005615	0.987	extracellular space
GO:0031410	0.987	cytoplasmic vesicle
GO:0043230	0.975	extracellular organelle
GO:0070062	0.970	extracellular exosome
GO:0016020	0.949	membrane
GO:0005794	0.888	Golgi apparatus
GO:0005768	0.886	endosome
GO:0005634	0.839	nucleus
GO:0000323	0.836	lytic vacuole
GO:0031984	0.818	organelle subcompartment
GO:0005764	0.816	lysosome
GO:0005775	0.793	vacuolar lumen
GO:0043202	0.780	lysosomal lumen
GO:0005770	0.684	late endosome
GO:0098791	0.543	Golgi apparatus subcompartment
GO:0005802	0.529	trans-Golgi network
GO:0071944	0.391	cell periphery
GO:0031981	0.320	nuclear lumen
GO:0031090	0.311	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.772	Hydrolases.

[back to server]