StarFunc result for job id Q9BWT7

User Input

>input (1032 residues)
MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLARALNPAKLTPYLRQCRVIDEQ
DEEEVLSTYRFPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQ
AQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLK
VSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLVSELRAENQRLTASLRELQEG
LQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQEM
EDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYR
KQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLS
EFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDP
APPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAI
RVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAAGLEGA
CLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPERAD
PHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNYQRAQQLLEVQEKCL
PSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPL
LVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPA
TPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGR
PGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVEC
GSSRGCPSSSEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWT7	1.000	1.000	0.000	1032	1.000	1.000	Q9BWT7.pdb.gz	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
2	AFDB:Q5F3W0	0.218	0.195	2.901E-57	1170	0.359	0.316	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
3	AFDB:Q8CIS0	0.257	0.232	4.903E-57	1159	0.358	0.318	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
4	AFDB:A0A494C1N2	0.230	0.234	2.621E-43	1013	0.279	0.284	A0A494C1N2.pdb.gz	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
5	AFDB:Q9H257	0.140	0.258	1.026E-20	536	0.188	0.362	Q9H257.pdb.gz	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
6	AFDB:A2AIV8	0.138	0.253	4.410E-20	536	0.180	0.347	A2AIV8.pdb.gz	CARD9_MOUSE Caspase recruitment domain-containing protein 9 OS=Mus musculus OX=10090 GN=Card9 PE=1 SV=1
7	PDB:2xkxA	0.182	0.251	1.142E-8	721	0.058	0.083	2xkxA.pdb.gz
8	PDB:7mixC	0.123	0.310	1.322E-7	324	0.055	0.176	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
9	AFDB:Q0DY81	0.112	0.101	7.139E-6	1155	0.154	0.138	Q0DY81.pdb.gz	NMCPA_ORYSJ Nuclear matrix constituent protein 1a OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1A PE=2 SV=1
10	AFDB:O75335	0.109	0.097	8.022E-6	1185	0.142	0.124	O75335.pdb.gz	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3
11	AFDB:I0J0E7	0.086	0.077	1.524E-5	1217	0.127	0.108	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
12	AFDB:A0A166B1A6	0.112	0.104	4.353E-5	1119	0.123	0.113	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
13	PDB:3ehqA	0.043	0.223	9.099E-3	182	0.016	0.088	3ehqA.pdb.gz
14	PDB:6nuiA	0.105	0.405	1.630E-2	198	0.035	0.182	6nuiA.pdb.gz
15	PDB:1griA	0.046	0.212	2.313E-2	211	0.008	0.038	1griA.pdb.gz
16	PDB:6mksA	0.078	0.794	3.480E-2	90	0.013	0.144	6mksA.pdb.gz
17	PDB:4f4jA	0.102	0.414	4.145E-2	189	0.025	0.138	4f4jA.pdb.gz
18	PDB:2lqnA	0.046	0.148	4.658E-2	303	0.016	0.053	2lqnA.pdb.gz
19	PDB:1k0xA	0.050	0.377	5.548E-2	108	0.009	0.083	1k0xA.pdb.gz
20	PDB:2anbA	0.106	0.437	5.548E-2	206	0.027	0.136	2anbA.pdb.gz	Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58660	0.0	1808	1021	0.896	0.906	CAR10_MOUSE Caspase recruitment domain-containing protein 10 OS=Mus musculus OX=10090 GN=Card10 PE=1 SV=1
2	Q17RA1	0.0	2049	1030	0.998	1.000	Q17RA1_HUMAN Caspase recruitment domain family, member 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=1
3	Q9BWT7	0.0	2058	1032	1.000	1.000	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
4	Q8CIS0	8.02e-179	554	1159	0.393	0.350	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
5	Q9BXL7	3.78e-125	412	1154	0.355	0.317	CAR11_HUMAN Caspase recruitment domain-containing protein 11 OS=Homo sapiens OX=9606 GN=CARD11 PE=1 SV=3
6	Q5F3W0	9.47e-123	405	1170	0.219	0.193	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
7	Q9BXL6	2.30e-76	273	1004	0.302	0.311	CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=2
8	Q9EPY0	2.23e-75	260	536	0.160	0.308	CARD9_RAT Caspase recruitment domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Card9 PE=1 SV=1
9	A0A494C1N2	4.22e-75	270	1013	0.301	0.307	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
10	Q9H257	1.46e-74	258	536	0.179	0.345	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
11	A2AIV8	7.57e-72	250	536	0.158	0.304	CARD9_MOUSE Caspase recruitment domain-containing protein 9 OS=Mus musculus OX=10090 GN=Card9 PE=1 SV=1
12	A0A8I6AP88	1.03e-06	55.5	1129	0.084	0.077	A0A8I6AP88_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
13	P70625	1.03e-06	55.5	813	0.084	0.107	P70625_RAT Zonula occludens 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=ZO-2 PE=2 SV=2
14	A0A8I6GLX8	1.11e-06	55.5	1189	0.084	0.073	A0A8I6GLX8_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=4 SV=1
15	Q3ZB99	1.26e-06	55.1	1164	0.084	0.075	Q3ZB99_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
16	A0A8J8Y4W9	1.28e-06	55.1	1166	0.084	0.075	A0A8J8Y4W9_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
17	A0A8I6ALD4	1.40e-06	55.1	1239	0.084	0.070	A0A8I6ALD4_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
18	G5E9E7	6.91e-06	52.8	1692	0.081	0.050	G5E9E7_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
19	A0A0G2K2P5	7.25e-06	52.8	1765	0.083	0.049	ZO1_RAT Tight junction protein ZO-1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=1
20	G3V1L9	8.01e-06	52.8	1861	0.081	0.045	G3V1L9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05289 BLYB	3.7e+02	12.8	Borrelia hemolysin accessory protein
2	PF00619 CARD	1.8e-16	71.2	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359612	0.999	B-cell lymphoma/leukemia 10
2	9606.ENSP00000319279	0.991	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
3	9606.ENSP00000483825	0.945	NF-kappa-B essential modulator
4	9606.ENSP00000380150	0.913	Caspase recruitment domain-containing protein 11
5	9606.ENSP00000303992	0.885	Transmembrane protein 43
6	9606.ENSP00000458715	0.857	Caspase recruitment domain-containing protein 14
7	9606.ENSP00000305355	0.853	Protein kinase C beta type
8	9606.ENSP00000263125	0.847	Protein kinase C theta type
9	9606.ENSP00000433623	0.742	TNF receptor-associated factor 6
10	9606.ENSP00000357199	0.589	Protein RRNAD1
11	9606.ENSP00000358994	0.572	Unconventional myosin-VI
12	9606.ENSP00000250498	0.562	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
13	9606.ENSP00000347672	0.554	VANGL planar cell polarity protein 1
14	9606.ENSP00000434614	0.525	Cell division cycle protein 27 homolog
15	9606.ENSP00000430684	0.514	Inhibitor of nuclear factor kappa-B kinase subunit beta
16	9606.ENSP00000409581	0.511	Beta-arrestin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.993	cellular process
GO:0048518	0.992	positive regulation of biological process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0042325	0.975	regulation of phosphorylation
GO:0048522	0.973	positive regulation of cellular process
GO:0009893	0.971	positive regulation of metabolic process
GO:0031399	0.967	regulation of protein modification process
GO:0007154	0.966	cell communication
GO:0023052	0.965	signaling
GO:0010604	0.962	positive regulation of macromolecule metabolic process
GO:0051239	0.961	regulation of multicellular organismal process
GO:0044093	0.960	positive regulation of molecular function
GO:0051716	0.949	cellular response to stimulus
GO:0051247	0.945	positive regulation of protein metabolic process
GO:0007165	0.940	signal transduction
GO:0045937	0.925	positive regulation of phosphate metabolic process
GO:0048523	0.921	negative regulation of cellular process
GO:0042327	0.920	positive regulation of phosphorylation
GO:0031401	0.913	positive regulation of protein modification process
GO:0050790	0.912	regulation of catalytic activity
GO:0001932	0.896	regulation of protein phosphorylation
GO:0043085	0.832	positive regulation of catalytic activity
GO:0051338	0.821	regulation of transferase activity
GO:0035556	0.772	intracellular signal transduction
GO:0010468	0.696	regulation of gene expression
GO:0001934	0.653	positive regulation of protein phosphorylation
GO:0051347	0.529	positive regulation of transferase activity
GO:0009889	0.508	regulation of biosynthetic process
GO:0045859	0.508	regulation of protein kinase activity
GO:0031326	0.504	regulation of cellular biosynthetic process
GO:0019219	0.501	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.440	regulation of macromolecule biosynthetic process
GO:0045860	0.426	positive regulation of protein kinase activity
GO:0051252	0.425	regulation of RNA metabolic process
GO:0006355	0.419	regulation of DNA-templated transcription
GO:0048583	0.404	regulation of response to stimulus
GO:0051090	0.404	regulation of DNA-binding transcription factor activity
GO:0023051	0.399	regulation of signaling
GO:0010646	0.399	regulation of cell communication
GO:0009966	0.394	regulation of signal transduction
GO:1902531	0.379	regulation of intracellular signal transduction
GO:0032879	0.368	regulation of localization
GO:0048584	0.366	positive regulation of response to stimulus
GO:0009967	0.353	positive regulation of signal transduction
GO:1902533	0.310	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.995	organelle
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005634	0.982	nucleus
GO:0032991	0.968	protein-containing complex
GO:0070013	0.958	intracellular organelle lumen
GO:0016020	0.954	membrane
GO:0031981	0.951	nuclear lumen
GO:0071944	0.933	cell periphery
GO:0005654	0.905	nucleoplasm
GO:0005886	0.845	plasma membrane
GO:0012505	0.311	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]