StarFunc result for job id Q9BWU0

User Input

>input (796 residues)
MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISKLHRLRMADILS
QSETLASQDLSGDFKKPALPVSPAARSKAPASSSSNPEEVQKEGPTALQDSNSGEPDIPP
PQPDCGDFRSLQEEQSRPPTAVSSPGGPARAPPYQEPPWGGPATAPYSLETLKGGTILGT
RSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTH
GTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQ
ILLEKKMLGEDSDEEEEMDTSERKINAGSQDDEMGCTWGMGEDAVEDDAEENPIVLEFQQ
EREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHS
GKKKEAMIQCSLEACRILDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLIEK
KRLNRMKKAGKIDEKPETFESLVAKLNDAERELSEISERLKASSQVLSESPSQDSLDAFM
SEMKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKIVKPAEIPELKKTETQTTGAENKA
KKLTLPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPTLMRMKDEPEVEEEEEEEEEEEKE
KEEHEKKKLEDGSLSRPQPEIEPEAAVQEMRPPTDLTHFKETQTHENMSQLSEEEQNKDY
QDCSKTTSLCAGPSASKNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDDPDYCVWVPPE
GQSGDGRTHLNDKYGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWU0	1.000	1.000	0.000	796	1.000	1.000	Q9BWU0.pdb.gz	NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
2	PDB:7dvqX	0.144	0.689	1.487E-12	156	0.057	0.288	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
3	PDB:5gm6U	0.128	0.547	3.014E-8	176	0.036	0.165	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
4	AFDB:B7SY83	0.128	0.071	4.662E-8	1477	0.122	0.066	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
5	PDB:2ff4A	0.109	0.221	6.660E-7	379	0.033	0.069	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
6	PDB:5z56X	0.126	0.585	2.096E-6	159	0.028	0.138	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
7	PDB:6l9wD	0.099	0.494	1.034E-4	142	0.024	0.134	6l9wD.pdb.gz
8	PDB:2kb3A	0.113	0.562	1.377E-4	143	0.034	0.189	2kb3A.pdb.gz
9	PDB:7wrgA	0.115	0.113	1.731E-4	812	0.041	0.041	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
10	AFDB:Q5T5U3	0.061	0.034	1.001E-3	1958	0.143	0.058	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
11	AFDB:P49750	0.071	0.035	1.677E-3	2146	0.138	0.051	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
12	AFDB:O13736	0.061	0.039	6.638E-3	1420	0.147	0.082	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
13	PDB:2kfuA	0.105	0.439	1.014E-2	162	0.036	0.179	2kfuA.pdb.gz
14	AFDB:Q54MI3	0.068	0.053	1.321E-2	1278	0.133	0.083	Q54MI3.pdb.gz	SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum OX=44689 GN=sun2 PE=3 SV=1
15	AFDB:Q5PSV9	0.119	0.059	1.398E-2	1707	0.106	0.049	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
16	AFDB:P53438	0.050	0.051	1.863E-2	785	0.129	0.131	P53438.pdb.gz	SOK2_YEAST Protein SOK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOK2 PE=1 SV=1
17	AFDB:Q4GYD0	0.061	0.037	2.089E-2	1484	0.137	0.073	Q4GYD0.pdb.gz	Q4GYD0_TRYB2 Minichromosome loss protein Mcl1 middle region domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4480 PE=4 SV=1
18	AFDB:Q99PP7	0.053	0.040	2.212E-2	1142	0.141	0.098	Q99PP7.pdb.gz	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
19	PDB:7v6cB	0.076	0.221	3.379E-2	260	0.016	0.050	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
20	PDB:8dgaK	0.078	0.295	7.119E-2	182	0.028	0.121	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WWF4	0.0	1050	566	0.655	0.920	A0A087WWF4_HUMAN Solute carrier family 4 member 1 adaptor protein OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=2
2	A0A087X0M4	0.0	1511	742	0.932	1.000	A0A087X0M4_HUMAN Solute carrier family 4 member 1 adaptor protein OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
3	E9PX68	0.0	1043	744	0.736	0.788	E9PX68_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
4	E9Q1Q0	0.0	823	534	0.552	0.822	E9Q1Q0_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
5	E9Q585	0.0	1000	715	0.716	0.797	E9Q585_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
6	O54716	0.0	739	507	0.541	0.850	O54716_MOUSE Kanadaptin OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
7	Q3UHY0	0.0	656	463	0.486	0.836	Q3UHY0_MOUSE Kanadaptin OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
8	Q3UUI2	0.0	827	536	0.553	0.821	Q3UUI2_MOUSE FHA domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
9	Q5BKS1	0.0	744	507	0.544	0.854	Q5BKS1_MOUSE Solute carrier family 4 (Anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=2
10	Q6GQW1	0.0	827	537	0.554	0.821	Q6GQW1_MOUSE Slc4a1ap protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
11	Q9BWU0	0.0	1623	796	1.000	1.000	NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
12	A0A0J9YTU2	1.17e-52	183	198	0.117	0.470	A0A0J9YTU2_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
13	A0A0J9YU76	2.60e-37	138	135	0.104	0.615	A0A0J9YU76_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
14	Q7TNP8	3.25e-23	97.8	129	0.070	0.434	Q7TNP8_MOUSE Slc4a1ap protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
15	A0A0J9YUT6	2.48e-22	93.6	80	0.069	0.688	A0A0J9YUT6_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
16	Q57XM6	8.94e-13	73.2	383	0.060	0.125	Q57XM6_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.530 PE=1 SV=1
17	Q9FIK2	4.88e-12	70.9	369	0.059	0.127	PP1R8_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g47790 PE=1 SV=1
18	Q55EZ0	5.42e-12	69.3	268	0.053	0.157	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
19	Q4V8W8	1.66e-11	68.9	374	0.054	0.115	Q4V8W8_DANRE Smad nuclear-interacting protein OS=Danio rerio OX=7955 GN=snip1 PE=1 SV=1
20	Q8BIZ6	2.38e-11	68.6	383	0.054	0.112	SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus OX=10090 GN=Snip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03368 Dicer_dimer	21	16.6	Dicer dimerisation domain
2	PF00035 dsrm	0.36	22.9	Double-stranded RNA binding motif
3	PF00498 FHA	1.2e-14	65.8	FHA domain
4	PF16697 Yop-YscD_cpl	1.9	20.1	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000206542	0.950	Probable tRNA N6-adenosine threonylcarbamoyltransferase
2	9606.ENSP00000349124	0.708	Serine/threonine-protein phosphatase 4 regulatory subunit 2
3	9606.ENSP00000450864	0.683	Serine/threonine-protein phosphatase 4 regulatory subunit 3A
4	9606.ENSP00000422753	0.675	Probable ATP-dependent RNA helicase DDX41
5	9606.ENSP00000436901	0.674	Zinc finger protein ubi-d4
6	9606.ENSP00000233557	0.635	Nuclear receptor-binding protein
7	9606.ENSP00000310129	0.575	26S proteasome non-ATPase regulatory subunit 2
8	9606.ENSP00000360532	0.568	Cell division cycle 5-like protein
9	9606.ENSP00000266070	0.549	Death-inducer obliterator 1
10	9606.ENSP00000272647	0.543	AMMECR1-like protein
11	9606.ENSP00000386488	0.536	Zinc finger CCCH domain-containing protein 8
12	9606.ENSP00000254193	0.529	U2 small nuclear ribonucleoprotein A
13	9606.ENSP00000354645	0.525	G patch domain-containing protein 3
14	9606.ENSP00000338235	0.523	Protein LYRIC
15	9606.ENSP00000386190	0.519	Uncharacterized protein C2orf16
16	9606.ENSP00000336750	0.515	SPT7 like, STAGA complex gamma subunit
17	9606.ENSP00000370109	0.513	PC4 and SFRS1-interacting protein
18	9606.ENSP00000365588	0.511	Mediator of DNA damage checkpoint protein 1
19	9606.ENSP00000245680	0.509	Solute carrier family 35 member F5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.355	nucleic acid binding
GO:0003723	0.317	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0006725	0.941	cellular aromatic compound metabolic process
GO:0006139	0.932	nucleobase-containing compound metabolic process
GO:0090304	0.918	nucleic acid metabolic process
GO:0016070	0.896	RNA metabolic process
GO:0010467	0.746	gene expression
GO:0006396	0.743	RNA processing
GO:0065007	0.674	biological regulation
GO:0050789	0.650	regulation of biological process
GO:0008380	0.546	RNA splicing
GO:0050794	0.481	regulation of cellular process
GO:0000377	0.471	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0019222	0.409	regulation of metabolic process
GO:0060255	0.378	regulation of macromolecule metabolic process
GO:0050896	0.339	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	1.000	nucleoplasm
GO:0005737	0.629	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]