StarFunc result for job id Q9BWU1

User Input

>input (502 residues)
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGIS
MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKP
MQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLN
EDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQST
LGYSSSSQQSSQYHPSHQAHRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWU1	0.999	0.999	5.950E-90	502	1.000	1.000	Q9BWU1.pdb.gz	CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
2	AFDB:P49336	0.723	0.782	3.245E-74	464	0.775	0.838	P49336.pdb.gz	CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens OX=9606 GN=CDK8 PE=1 SV=1
3	AFDB:Q9VT57	0.728	0.804	1.322E-64	454	0.618	0.683	Q9VT57.pdb.gz	CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster OX=7227 GN=Cdk8 PE=1 SV=2
4	AFDB:F6QTA4	0.539	0.676	2.357E-56	398	0.791	0.997	F6QTA4.pdb.gz	F6QTA4_HUMAN Cyclin dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
5	PDB:7kpvA	0.604	0.836	2.148E-29	357	0.313	0.440	7kpvA.pdb.gz
6	PDB:4krcA	0.506	0.833	2.637E-24	297	0.221	0.374	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
7	AFDB:Q9CAG1	0.540	0.365	5.433E-24	752	0.257	0.172	Q9CAG1.pdb.gz	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1
8	PDB:4yc3A	0.511	0.846	1.372E-23	295	0.251	0.427	4yc3A.pdb.gz
9	PDB:4gcjA	0.484	0.770	1.824E-23	304	0.249	0.411	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
10	PDB:4eomC	0.473	0.836	2.044E-23	276	0.245	0.446	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
11	PDB:3mi9A	0.517	0.771	1.005E-22	329	0.221	0.337	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
12	PDB:1unlA	0.497	0.830	2.643E-22	292	0.233	0.401	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
13	PDB:4ek6A	0.463	0.802	5.537E-22	279	0.237	0.427	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
14	AFDB:Q9NYV4	0.545	0.197	2.133E-21	1490	0.279	0.094	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
15	AFDB:B9X2H6	0.472	0.226	3.362E-21	1080	0.245	0.114	B9X2H6.pdb.gz	B9X2H6_DANRE Cyclin dependent kinase like 5 long OS=Danio rerio OX=7955 GN=Cdkl5 PE=2 SV=1
16	PDB:6o9l8	0.515	0.835	3.618E-21	299	0.251	0.421	6o9l8.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7opmA	0.526	0.719	1.500E-20	362	0.221	0.307	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
18	AFDB:Q8IVW4	0.484	0.413	1.750E-20	592	0.231	0.196	Q8IVW4.pdb.gz	CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens OX=9606 GN=CDKL3 PE=1 SV=1
19	AFDB:A1L1U2	0.474	0.331	2.331E-18	737	0.235	0.160	A1L1U2.pdb.gz	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
20	AFDB:Q13627	0.472	0.319	3.098E-18	763	0.207	0.136	Q13627.pdb.gz	DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUQ1	0.0	785	457	0.876	0.963	A0A8I5ZUQ1_RAT Cyclin-dependent kinase 19 OS=Rattus norvegicus OX=10116 GN=Cdk19 PE=3 SV=1
2	A0A8I5ZVW8	0.0	619	416	0.683	0.825	A0A8I5ZVW8_RAT Cyclin-dependent kinase 8 OS=Rattus norvegicus OX=10116 GN=Cdk8 PE=3 SV=1
3	A0A8I5ZYM4	0.0	709	437	0.733	0.842	A0A8I5ZYM4_RAT Cyclin-dependent kinase 8 OS=Rattus norvegicus OX=10116 GN=Cdk8 PE=3 SV=1
4	D3ZDM6	0.0	1007	501	0.964	0.966	D3ZDM6_RAT Cyclin-dependent kinase 19 OS=Rattus norvegicus OX=10116 GN=Cdk19 PE=4 SV=1
5	F6QTA4	0.0	810	398	0.793	1.000	F6QTA4_HUMAN Cyclin dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
6	P49336	0.0	744	464	0.775	0.838	CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens OX=9606 GN=CDK8 PE=1 SV=1
7	Q8R3L8	0.0	763	464	0.773	0.836	CDK8_MOUSE Cyclin-dependent kinase 8 OS=Mus musculus OX=10090 GN=Cdk8 PE=1 SV=3
8	Q9BWU1	0.0	1049	502	1.000	1.000	CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
9	Q9VT57	0.0	654	454	0.610	0.674	CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster OX=7227 GN=Cdk8 PE=1 SV=2
10	Q95YH0	2.55e-101	311	380	0.335	0.442	CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum OX=44689 GN=cdk8 PE=2 SV=1
11	Q84TI6	3.31e-97	303	470	0.349	0.372	CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana OX=3702 GN=CDKE-1 PE=1 SV=2
12	O13958	1.45e-85	270	369	0.297	0.404	SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb10 PE=1 SV=2
13	P39073	8.88e-79	258	555	0.301	0.272	SSN3_YEAST Meiotic mRNA stability protein kinase SSN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN3 PE=1 SV=3
14	Q9CAG1	2.46e-66	229	752	0.255	0.170	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1
15	Q7T3L7	9.23e-63	208	302	0.253	0.421	Q7T3L7_DANRE Cell division control protein 2 OS=Danio rerio OX=7955 GN=cdc2 PE=1 SV=1
16	Q00526	2.12e-62	207	305	0.247	0.407	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
17	P24100	7.37e-62	206	294	0.251	0.429	CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana OX=3702 GN=CDKA-1 PE=1 SV=1
18	Q9FGW5	1.24e-61	214	612	0.245	0.201	CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana OX=3702 GN=CDKG1 PE=1 SV=1
19	P34117	1.73e-61	205	292	0.243	0.418	CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum OX=44689 GN=cdk5 PE=2 SV=2
20	P24941	3.90e-61	204	298	0.261	0.440	CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	13	17.1	Phosphotransferase enzyme family
2	PF06293 Kdo	14	16.5	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	5.4e-58	208.0	Protein kinase domain
4	PF17667 Pkinase_fungal	50	14.1	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	2.9e-22	90.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003806080.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003824404.1	0.972	Belongs to the cyclin family.
2	9597.XP_003814522.1	0.961	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	9597.XP_008971808.1	0.957	Mediator complex subunit 12
4	9597.XP_008956069.1	0.953	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	9597.XP_003819031.1	0.952	Mediator of RNA polymerase II transcription subunit 7
6	9597.XP_008963597.1	0.952	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
7	9597.XP_003808015.1	0.950	Mediator of RNA polymerase II transcription subunit 10
8	9597.XP_003810188.1	0.950	Mediator of RNA polymerase II transcription subunit 31
9	9597.XP_008976081.1	0.950	Mediator of RNA polymerase II transcription subunit 6 isoform X1
10	9597.XP_008966609.1	0.949	Mediator of RNA polymerase II transcription subunit 14
11	9597.XP_003823376.1	0.947	Mediator of RNA polymerase II transcription subunit 30 isoform X1
12	9597.XP_003828139.1	0.946	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	9597.XP_008951255.1	0.946	Mediator of RNA polymerase II transcription subunit 23 isoform X1
14	9597.XP_003831576.1	0.944	Mediator of RNA polymerase II transcription subunit 1
15	9597.XP_003811468.1	0.937	Mediator of RNA polymerase II transcription subunit 4 isoform X1
16	9597.XP_003826862.1	0.937	Mediator of RNA polymerase II transcription subunit 28
17	9597.XP_003813831.1	0.936	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
18	9597.XP_003826467.1	0.935	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
19	9597.XP_008960695.1	0.929	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
20	9597.XP_008964622.1	0.928	Mediator of RNA polymerase II transcription subunit 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.989	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0048518	0.931	positive regulation of biological process
GO:0019222	0.901	regulation of metabolic process
GO:0008152	0.895	metabolic process
GO:0080090	0.874	regulation of primary metabolic process
GO:0031323	0.858	regulation of cellular metabolic process
GO:0071704	0.851	organic substance metabolic process
GO:0044238	0.851	primary metabolic process
GO:0043170	0.840	macromolecule metabolic process
GO:0050896	0.828	response to stimulus
GO:0006807	0.827	nitrogen compound metabolic process
GO:0048522	0.791	positive regulation of cellular process
GO:0060255	0.740	regulation of macromolecule metabolic process
GO:0044237	0.716	cellular metabolic process
GO:0051171	0.714	regulation of nitrogen compound metabolic process
GO:0010468	0.633	regulation of gene expression
GO:0048583	0.622	regulation of response to stimulus
GO:0019219	0.576	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.562	regulation of biosynthetic process
GO:0048519	0.451	negative regulation of biological process
GO:0048523	0.441	negative regulation of cellular process
GO:0031326	0.426	regulation of cellular biosynthetic process
GO:0051252	0.411	regulation of RNA metabolic process
GO:0036211	0.408	protein modification process
GO:0009893	0.383	positive regulation of metabolic process
GO:0010604	0.358	positive regulation of macromolecule metabolic process
GO:0006355	0.350	regulation of DNA-templated transcription
GO:0051716	0.340	cellular response to stimulus
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process
GO:0031325	0.309	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005829	0.977	cytosol
GO:0032991	0.942	protein-containing complex
GO:0140513	0.661	nuclear protein-containing complex
GO:0016592	0.516	mediator complex
GO:0043228	0.335	non-membrane-bounded organelle
GO:0043232	0.334	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]