StarFunc result for job id Q9BWV1

User Input

>input (1114 residues)
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLD
PGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDH
GRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIP
PSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITF
TDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHL
QPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERP
VGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPS
CPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGEL
QQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQ
RQEQPAAVGQSGVRRAPDSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDWC
PQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0Z7	0.371	0.373	0.000	1108	0.859	0.864	D4A0Z7.pdb.gz	D4A0Z7_RAT BOC cell adhesion associated, oncogene regulated OS=Rattus norvegicus OX=10116 GN=Boc PE=4 SV=3
2	AFDB:Q9BWV1	1.000	1.000	0.000	1114	1.000	1.000	Q9BWV1.pdb.gz	BOC_HUMAN Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
3	AFDB:Q1L8D0	0.361	0.358	1.433E-93	1125	0.371	0.367	Q1L8D0.pdb.gz	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
4	AFDB:Q2EY14	0.334	0.325	6.228E-58	1149	0.197	0.191	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
5	AFDB:P43146	0.327	0.256	1.086E-56	1447	0.215	0.165	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
6	AFDB:A0A2R8QRK0	0.158	0.125	4.009E-55	1420	0.201	0.158	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	AFDB:Q9VPZ7	0.172	0.144	1.871E-53	1342	0.201	0.167	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
8	AFDB:A0A0G2JZA1	0.162	0.121	1.270E-51	1512	0.206	0.151	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
9	AFDB:A8JUV7	0.306	0.308	3.686E-49	1105	0.196	0.197	A8JUV7.pdb.gz	A8JUV7_DROME Brother of ihog, isoform G OS=Drosophila melanogaster OX=7227 GN=boi PE=1 SV=3
10	AFDB:D3ZB51	0.136	0.116	5.872E-41	1328	0.198	0.166	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
11	PDB:5oj2B	0.127	0.192	8.835E-27	692	0.114	0.184	5oj2B.pdb.gz
12	PDB:1e07A	0.119	0.187	1.651E-21	642	0.105	0.182	1e07A.pdb.gz
13	PDB:6dldD	0.124	0.408	1.508E-14	269	0.061	0.253	6dldD.pdb.gz
14	PDB:7sqcO0	0.112	0.110	6.113E-13	1140	0.084	0.082	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7q1yA	0.084	0.074	7.728E-13	1374	0.080	0.065	7q1yA.pdb.gz
16	PDB:6pxvA	0.084	0.109	3.802E-12	823	0.043	0.058	6pxvA.pdb.gz
17	PDB:6dlfA	0.101	0.387	5.532E-12	236	0.054	0.254	6dlfA.pdb.gz
18	PDB:8dtlA	0.082	0.117	5.532E-12	741	0.044	0.066	8dtlA.pdb.gz
19	PDB:8eyyA	0.083	0.113	5.532E-12	775	0.049	0.071	8eyyA.pdb.gz
20	PDB:5a42A	0.085	0.071	8.048E-12	1597	0.069	0.048	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A0Z7	0.0	1924	1110	0.861	0.864	D4A0Z7_RAT BOC cell adhesion associated, oncogene regulated OS=Rattus norvegicus OX=10116 GN=Boc PE=4 SV=3
2	Q1L8D0	0.0	643	1125	0.342	0.339	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
3	Q6AZB0	0.0	1902	1110	0.864	0.868	BOC_MOUSE Brother of CDO OS=Mus musculus OX=10090 GN=Boc PE=1 SV=2
4	Q8UVD6	0.0	1017	1032	0.487	0.526	Q8UVD6_DANRE Brother of CDO OS=Danio rerio OX=7955 GN=wu:fa16d03 PE=1 SV=1
5	Q9BWV1	0.0	2286	1114	1.000	1.000	BOC_HUMAN Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
6	O35158	6.36e-149	480	1256	0.305	0.271	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
7	Q32MD9	1.30e-147	476	1250	0.304	0.271	CDON_MOUSE Cell adhesion molecule-related/down-regulated by oncogenes OS=Mus musculus OX=10090 GN=Cdon PE=1 SV=2
8	Q4KMG0	2.63e-146	474	1287	0.305	0.264	CDON_HUMAN Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON PE=1 SV=2
9	Q96DN7	5.31e-78	254	157	0.112	0.796	Q96DN7_HUMAN BOC cell adhesion associated, oncogene regulated OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
10	P97798	6.22e-47	186	1492	0.189	0.141	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
11	Q49BB0	2.16e-46	184	1421	0.174	0.137	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
12	Q63155	4.11e-46	183	1445	0.171	0.132	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
13	P97603	5.01e-46	183	1377	0.186	0.150	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
14	P70211	5.06e-46	183	1447	0.172	0.133	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
15	P43146	1.31e-45	182	1447	0.170	0.131	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
16	Q3S3D7	5.13e-42	170	1441	0.181	0.140	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
17	A0A0R4IP15	2.28e-41	168	1428	0.184	0.144	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
18	A0A0R4IIB3	3.12e-41	168	1409	0.184	0.145	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
19	Q91562	3.45e-41	167	1427	0.164	0.128	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
20	Q8BQC3	1.02e-40	164	813	0.110	0.151	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	7.2	18.1	Penicillin-Binding Protein C-terminus Family
2	PF07654 C1-set	0.00074	31.2	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	2.2e-06	38.9	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	3.3e-32	122.0	Fibronectin type III domain
5	PF07679 I-set	5.8e-45	162.6	Immunoglobulin I-set domain
6	PF00047 ig	7.6e-31	117.5	Immunoglobulin domain
7	PF13895 Ig_2	5.9e-33	124.3	Immunoglobulin domain
8	PF13927 Ig_3	9.5e-49	175.2	Immunoglobulin domain
9	PF16680 Ig_4	4.1e-05	35.4	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	0.00016	33.4	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF17736 Ig_C17orf99	0.63	21.5	C17orf99 Ig domain
12	PF09294 Interfer-bind	1.6e+02	14.0	Interferon-alpha/beta receptor, fibronectin type III
13	PF16625 ISET-FN3_linker	1.9e-24	97.4	Unstructured linking region I-set and fnIII on Brother of CDO
14	PF16706 Izumo-Ig	0.12	23.7	Izumo-like Immunoglobulin domain
15	PF16656 Pur_ac_phosph_N	4.4e-05	35.4	Purple acid Phosphatase, N-terminal domain
16	PF07686 V-set	3.2e-11	54.7	Immunoglobulin V-set domain
17	PF07495 Y_Y_Y	36	15.7	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.989	Sonic hedgehog protein
2	9606.ENSP00000266991	0.986	Desert hedgehog protein
3	9606.ENSP00000298743	0.948	Growth arrest-specific protein 1
4	9606.ENSP00000249373	0.938	Smoothened homolog
5	9606.ENSP00000295731	0.938	Indian hedgehog protein
6	9606.ENSP00000332353	0.925	Protein patched homolog 1
7	9606.ENSP00000468348	0.900	Dual specificity mitogen-activated protein kinase kinase 6
8	9606.ENSP00000361266	0.897	Protein patched homolog 2
9	9606.ENSP00000376458	0.870	Cell adhesion molecule-related/down-regulated by oncogenes
10	9606.ENSP00000263816	0.820	Low-density lipoprotein receptor-related protein 2
11	9606.ENSP00000269141	0.804	Cadherin-2
12	9606.ENSP00000289746	0.714	Cadherin-15
13	9606.ENSP00000344456	0.708	Catenin beta-1
14	9606.ENSP00000341198	0.668	Neogenin
15	9606.ENSP00000293973	0.663	Netrin-3
16	9606.ENSP00000340874	0.657	Myocyte-specific enhancer factor 2C
17	9606.ENSP00000346389	0.654	Myocyte-specific enhancer factor 2A
18	9606.ENSP00000262965	0.650	Transcription factor E2-alpha
19	9606.ENSP00000271555	0.650	Myocyte-specific enhancer factor 2D
20	9606.ENSP00000267859	0.643	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048856	0.980	anatomical structure development
GO:0032501	0.976	multicellular organismal process
GO:0007275	0.966	multicellular organism development
GO:0048731	0.963	system development
GO:0048869	0.954	cellular developmental process
GO:0040011	0.950	locomotion
GO:0030154	0.916	cell differentiation
GO:0009653	0.914	anatomical structure morphogenesis
GO:0007399	0.898	nervous system development
GO:0032989	0.893	cellular component morphogenesis
GO:0042221	0.883	response to chemical
GO:0032990	0.695	cell part morphogenesis
GO:0006935	0.685	chemotaxis
GO:0048468	0.676	cell development
GO:0000902	0.666	cell morphogenesis
GO:0048858	0.647	cell projection morphogenesis
GO:0030182	0.645	neuron differentiation
GO:0048518	0.636	positive regulation of biological process
GO:0048666	0.635	neuron development
GO:0048812	0.632	neuron projection morphogenesis
GO:0000904	0.626	cell morphogenesis involved in differentiation
GO:0048667	0.594	cell morphogenesis involved in neuron differentiation
GO:0007411	0.566	axon guidance
GO:0048522	0.547	positive regulation of cellular process
GO:0051716	0.460	cellular response to stimulus
GO:0007154	0.423	cell communication
GO:0007165	0.412	signal transduction
GO:0048583	0.366	regulation of response to stimulus
GO:0023051	0.360	regulation of signaling
GO:0010646	0.358	regulation of cell communication
GO:0009966	0.347	regulation of signal transduction
GO:0050793	0.305	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.994	cell periphery
GO:0005886	0.979	plasma membrane
GO:0042995	0.805	cell projection
GO:0120025	0.800	plasma membrane bounded cell projection
GO:0005622	0.798	intracellular anatomical structure
GO:0043226	0.797	organelle
GO:0005737	0.791	cytoplasm
GO:0043229	0.604	intracellular organelle
GO:0043227	0.574	membrane-bounded organelle
GO:0043231	0.438	intracellular membrane-bounded organelle
GO:0030427	0.423	site of polarized growth
GO:0043005	0.414	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]