StarFunc result for job id Q9BWV3

User Input

>input (514 residues)
MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQK
NEEGKHGPLGDNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGS
RLKNCDLYFSRKPCSACLKMIVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERL
KSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKITKTLPDANTDFYYECKQERIKEYE
MLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLILLLATVASSVPNFKHFGFYR
SNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKSRSCDGTGAMY
FVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF
VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYG
LEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWV3	1.000	1.000	0.000	514	1.000	1.000	Q9BWV3.pdb.gz	CDAC1_HUMAN Cytidine and dCMP deaminase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CDADC1 PE=1 SV=1
2	AFDB:P32321	0.220	0.596	5.165E-9	178	0.074	0.213	P32321.pdb.gz	DCTD_HUMAN Deoxycytidylate deaminase OS=Homo sapiens OX=9606 GN=DCTD PE=1 SV=2
3	PDB:2w4lE	0.212	0.633	8.316E-9	162	0.070	0.222	2w4lE.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
4	PDB:2w4lC	0.213	0.709	1.817E-7	142	0.072	0.261	2w4lC.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
5	AFDB:O43012	0.195	0.300	5.178E-6	322	0.086	0.137	O43012.pdb.gz	DCTD_SCHPO Deoxycytidylate deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.13c PE=3 SV=2
6	AFDB:P06773	0.225	0.355	5.178E-6	312	0.099	0.163	P06773.pdb.gz	DCTD_YEAST Deoxycytidylate deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCD1 PE=1 SV=2
7	AFDB:P68398	0.147	0.400	1.891E-4	167	0.049	0.150	P68398.pdb.gz	TADA_ECOLI tRNA-specific adenosine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=tadA PE=1 SV=2
8	AFDB:O94642	0.172	0.219	3.752E-4	389	0.074	0.098	O94642.pdb.gz	TAD2_SCHPO tRNA-specific adenosine deaminase subunit tad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tad2 PE=1 SV=2
9	PDB:1z3aA	0.140	0.418	4.289E-4	156	0.043	0.141	1z3aA.pdb.gz	Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase.
10	PDB:6vpcF	0.120	0.364	7.172E-4	156	0.037	0.122	6vpcF.pdb.gz	DNA capture by a CRISPR-Cas9-guided adenine base editor.
11	PDB:3g8qA	0.143	0.254	7.593E-4	278	0.029	0.054	3g8qA.pdb.gz	A cytidine deaminase edits C to U in transfer RNAs in Archaea
12	AFDB:A0A0H2UMZ1	0.150	0.449	8.838E-4	155	0.053	0.174	A0A0H2UMZ1.pdb.gz	A0A0H2UMZ1_STRPN tRNA-specific adenosine deaminase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tadA PE=1 SV=1
13	AFDB:Q6IDB6	0.122	0.320	8.838E-4	182	0.045	0.126	Q6IDB6.pdb.gz	TAD2_ARATH tRNA-specific adenosine deaminase TAD2 OS=Arabidopsis thaliana OX=3702 GN=TAD2 PE=1 SV=1
14	AFDB:P15639	0.286	0.279	1.318E-3	529	0.076	0.074	P15639.pdb.gz	PUR9_ECOLI Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) OX=83333 GN=purH PE=1 SV=1
15	AFDB:P78594	0.149	0.464	3.105E-3	150	0.056	0.193	P78594.pdb.gz	FCA1_CANAL Cytosine deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FCA1 PE=3 SV=1
16	PDB:7bv5A	0.140	0.277	3.757E-3	234	0.051	0.111	7bv5A.pdb.gz	Crystal structure of the yeast heterodimeric ADAT2/3 deaminase.
17	PDB:1ox7B	0.142	0.398	4.999E-3	161	0.049	0.155	1ox7B.pdb.gz	The 1.14 a crystal structure of yeast Cytosine deaminase. Evolution of nucleotide salvage enzymes and implications for genetic chemotherapy.
18	PDB:7bv5D	0.144	0.223	5.293E-3	310	0.045	0.074	7bv5D.pdb.gz	Crystal structure of the yeast heterodimeric ADAT2/3 deaminase.
19	PDB:7bv5C	0.119	0.205	7.042E-3	284	0.033	0.060	7bv5C.pdb.gz	Crystal structure of the yeast heterodimeric ADAT2/3 deaminase.
20	PDB:8aw32	0.143	0.338	8.850E-3	177	0.047	0.136	8aw32.pdb.gz	Structural basis for sequence-independent substrate selection by eukaryotic wobble base tRNA deaminase ADAT2/3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BWV3	0.0	1080	514	1.000	1.000	CDAC1_HUMAN Cytidine and dCMP deaminase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CDADC1 PE=1 SV=1
2	P32321	2.54e-05	47.4	178	0.076	0.219	DCTD_HUMAN Deoxycytidylate deaminase OS=Homo sapiens OX=9606 GN=DCTD PE=1 SV=2
3	Q59072	0.059	38.1	377	0.039	0.053	SPSS_METJA O-phospho-L-seryl-tRNA:Cys-tRNA synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=pscS PE=1 SV=2
4	Q8GWP5	0.19	36.6	426	0.056	0.068	RIBD_ARATH Riboflavin biosynthesis protein PYRD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYRD PE=1 SV=1
5	P25539	0.33	35.8	367	0.049	0.068	RIBD_ECOLI Riboflavin biosynthesis protein RibD OS=Escherichia coli (strain K12) OX=83333 GN=ribD PE=1 SV=1
6	Q96EY9	1.9	33.5	351	0.027	0.040	ADAT3_HUMAN Probable inactive tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens OX=9606 GN=ADAT3 PE=1 SV=1
7	Q10287	2.7	33.5	1729	0.031	0.009	FKS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgs1 PE=1 SV=1
8	O59834	3.3	32.0	162	0.033	0.105	FCYS_SCHPO Probable cytosine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.14c PE=3 SV=1
9	Q8IZF0	3.6	33.1	1738	0.053	0.016	NALCN_HUMAN Sodium leak channel NALCN OS=Homo sapiens OX=9606 GN=NALCN PE=1 SV=1
10	Q8BXR5	3.9	32.7	1738	0.053	0.016	NALCN_MOUSE Sodium leak channel NALCN OS=Mus musculus OX=10090 GN=Nalcn PE=1 SV=2
11	F1QJB6	4.8	32.7	3091	0.025	0.004	F1QJB6_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=atm PE=1 SV=2
12	O43012	6.0	32.0	322	0.058	0.093	DCTD_SCHPO Deoxycytidylate deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.13c PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18767 AID	2.5e+02	13.1	Activation induced deaminase
2	PF00383 dCMP_cyt_deam_1	7.2e-16	69.3	Cytidine and deoxycytidylate deaminase zinc-binding region
3	PF14437 MafB19-deam	1.3e-09	49.3	MafB19-like deaminase
4	PF18750 SNAD4	45	15.6	Secreted Novel AID/APOBEC-like Deaminase 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349576	0.756	Deoxycytidylate deaminase
2	9606.ENSP00000282026	0.746	ADP-ribosylation factor-like protein 11
3	9606.ENSP00000355986	0.711	Synaptotagmin-14
4	9606.ENSP00000297459	0.700	Transmembrane protein 74
5	9606.ENSP00000315644	0.698	Thymidylate synthase
6	9606.ENSP00000367552	0.698	RCC1 and BTB domain-containing protein 1
7	9606.ENSP00000461382	0.677	Large neutral amino acids transporter small subunit 4
8	9606.ENSP00000218721	0.675	Motilin receptor
9	9606.ENSP00000479669	0.674	Calcium-binding protein 39-like
10	9606.ENSP00000367691	0.653	Lysophosphatidic acid receptor 6
11	9606.ENSP00000367828	0.642	Integral membrane protein 2B
12	9606.ENSP00000376272	0.642	Replication factor C subunit 4
13	9606.ENSP00000370376	0.624	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
14	9606.ENSP00000364212	0.623	Cytidine deaminase
15	9606.ENSP00000348442	0.618	26S proteasome non-ATPase regulatory subunit 12
16	9606.ENSP00000295317	0.606	E3 ubiquitin-protein ligase RNF149
17	9606.ENSP00000310572	0.606	26S proteasome regulatory subunit 8
18	9606.ENSP00000401802	0.605	26S proteasome regulatory subunit 10B
19	9606.ENSP00000219313	0.597	26S proteasome non-ATPase regulatory subunit 7
20	9606.ENSP00000441831	0.593	Fibronectin type-III domain-containing protein 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061676	1.000	importin-alpha family protein binding
GO:0042803	1.000	protein homodimerization activity
GO:0008270	1.000	zinc ion binding
GO:0004126	1.000	cytidine deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0072527	0.971	pyrimidine-containing compound metabolic process
GO:0055086	0.970	nucleobase-containing small molecule metabolic process
GO:1901135	0.958	carbohydrate derivative metabolic process
GO:1901565	0.912	organonitrogen compound catabolic process
GO:0009164	0.899	nucleoside catabolic process
GO:0072529	0.891	pyrimidine-containing compound catabolic process
GO:0042454	0.891	ribonucleoside catabolic process
GO:0043170	0.847	macromolecule metabolic process
GO:0090304	0.804	nucleic acid metabolic process
GO:0006259	0.790	DNA metabolic process
GO:0043412	0.709	macromolecule modification
GO:0006304	0.613	DNA modification
GO:0050789	0.413	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.882	intracellular organelle lumen
GO:0031981	0.777	nuclear lumen
GO:0005654	0.761	nucleoplasm
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16069	1.000	cytidine + H(+) + H2O = NH4(+) + uridine
EC:3.5.4.5	1.000	cytidine deaminase.

[back to server]