StarFunc result for job id Q9BWX5

User Input

>input (397 residues)
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAA
RPGWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGAL
LPREQFAAPLGRPVGTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLE
EFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAG
LCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHL
EFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BWX5	0.999	0.999	7.849E-63	397	1.000	1.000	Q9BWX5.pdb.gz	GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens OX=9606 GN=GATA5 PE=1 SV=1
2	AFDB:P97489	0.437	0.431	8.990E-50	404	0.768	0.755	P97489.pdb.gz	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
3	AFDB:F1NZV5	0.302	0.306	1.442E-36	391	0.627	0.637	F1NZV5.pdb.gz	F1NZV5_CHICK GATA binding protein 5 OS=Gallus gallus OX=9031 GN=GATA5 PE=4 SV=3
4	AFDB:Q1JQ00	0.315	0.324	5.762E-33	383	0.519	0.538	Q1JQ00.pdb.gz
5	AFDB:E1C9C6	0.294	0.286	3.652E-28	410	0.501	0.485	E1C9C6.pdb.gz
6	AFDB:Q5A432	0.151	0.091	2.403E-7	688	0.181	0.105	Q5A432.pdb.gz	GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAT1 PE=2 SV=1
7	AFDB:Q58A45	0.078	0.041	1.076E-1	887	0.196	0.088	Q58A45.pdb.gz	PAN3_HUMAN PAN2-PAN3 deadenylation complex subunit PAN3 OS=Homo sapiens OX=9606 GN=PAN3 PE=1 SV=3
8	PDB:5dkaA	0.076	0.281	2.151E-1	96	0.040	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
9	PDB:1b8tA	0.080	0.148	2.633E-1	192	0.060	0.125	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
10	AFDB:Q6TEL1	0.082	0.057	2.958E-1	643	0.154	0.095	Q6TEL1.pdb.gz	RA21A_DANRE Double-strand-break repair protein rad21 homolog A OS=Danio rerio OX=7955 GN=rad21a PE=1 SV=1
11	PDB:6ydhA	0.076	0.311	6.767E-1	62	0.020	0.129	6ydhA.pdb.gz
12	AFDB:Q09829	0.082	0.047	9.954E-1	780	0.136	0.069	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1
13	PDB:1imlA	0.076	0.300	1.241	76	0.048	0.250	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	AFDB:D3ZHK8	0.081	0.051	1.303	717	0.184	0.102	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
15	PDB:5a2qd	0.079	0.416	1.328	55	0.028	0.200	5a2qd.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
16	PDB:2pv0B	0.071	0.079	1.421	347	0.045	0.052	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
17	PDB:4kfzB	0.077	0.183	1.421	148	0.038	0.101	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:7pzye	0.088	0.504	1.520	55	0.025	0.182	7pzye.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:1q3bA	0.048	0.067	1.990	259	0.018	0.027	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
20	PDB:5gm6a	0.077	0.224	1.990	123	0.043	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97489	0.0	576	404	0.768	0.755	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
2	Q9BWX5	0.0	798	397	1.000	1.000	GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens OX=9606 GN=GATA5 PE=1 SV=1
3	P43695	7.42e-142	410	390	0.574	0.585	GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis OX=8355 GN=gata5-a PE=2 SV=1
4	P43692	1.90e-136	397	391	0.627	0.637	GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus OX=9031 GN=GATA5 PE=1 SV=1
5	Q9W6U0	5.16e-134	390	383	0.569	0.590	Q9W6U0_DANRE GATA-binding protein 5 OS=Danio rerio OX=7955 GN=cb634 PE=2 SV=2
6	F1NZV5	1.07e-133	390	391	0.627	0.637	F1NZV5_CHICK GATA binding protein 5 OS=Gallus gallus OX=9031 GN=GATA5 PE=4 SV=3
7	Q91677	1.77e-111	333	392	0.499	0.505	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
8	Q09JY7	1.15e-97	296	352	0.438	0.494	Q09JY7_DANRE GATA4 OS=Danio rerio OX=7955 GN=gata PE=2 SV=1
9	P43691	2.74e-96	294	380	0.456	0.476	GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1
10	P70005	1.21e-95	293	391	0.479	0.486	GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis OX=8355 GN=gata6-b PE=2 SV=1
11	Q6NW63	1.53e-95	296	501	0.481	0.381	Q6NW63_DANRE GATA-binding protein 6 OS=Danio rerio OX=7955 GN=GATA-5 PE=2 SV=2
12	Q61169	6.19e-90	285	589	0.491	0.331	GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus OX=10090 GN=Gata6 PE=1 SV=3
13	I3LUZ9	5.07e-88	275	443	0.516	0.463	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
14	Q08369	3.44e-87	273	441	0.511	0.460	GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus OX=10090 GN=Gata4 PE=1 SV=4
15	P43694	6.68e-87	272	442	0.519	0.466	GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2
16	P46152	1.83e-86	271	440	0.501	0.452	GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus OX=10116 GN=Gata4 PE=1 SV=1
17	Q8MIM5	3.05e-86	270	442	0.511	0.459	Q8MIM5_PIG Transcription factor GATA-4 OS=Sus scrofa OX=9823 PE=2 SV=1
18	P46153	2.49e-85	272	587	0.484	0.327	GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus OX=10116 GN=Gata6 PE=1 SV=2
19	Q92908	4.77e-84	269	595	0.496	0.331	GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6 PE=1 SV=2
20	A0A087WZ09	1.17e-79	253	441	0.383	0.345	A0A087WZ09_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	3.6e+02	12.6	Putative GTPase activating protein for Arf
2	PF18912 DZR_2	7.8e+02	11.4	Double zinc ribbon domain
3	PF01873 eIF-5_eIF-2B	1e+02	14.2	Domain found in IF2B/IF5
4	PF00320 GATA	1.3e-26	103.2	GATA zinc finger
5	PF05349 GATA-N	2.1e-48	176.4	GATA-type transcription activator, N-terminal
6	PF08271 TF_Zn_Ribbon	0.27	22.1	TFIIB zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.860	Homeobox protein Nkx-2.5
2	9606.ENSP00000257555	0.837	Hepatocyte nuclear factor 1-alpha
3	9606.ENSP00000264162	0.817	Lactase-phlorizin hydrolase
4	9606.ENSP00000384179	0.783	Zinc finger protein ZFPM2
5	9606.ENSP00000326630	0.724	Zinc finger protein ZFPM1
6	9606.ENSP00000352565	0.699	Heart- and neural crest derivatives-expressed protein 2
7	9606.ENSP00000388620	0.685	Eomesodermin homolog
8	9606.ENSP00000297316	0.684	Transcription factor SOX-17
9	9606.ENSP00000309913	0.671	T-box transcription factor TBX5
10	9606.ENSP00000250448	0.669	Hepatocyte nuclear factor 3-alpha
11	9606.ENSP00000381104	0.668	Transmembrane 9 superfamily member 4
12	9606.ENSP00000231498	0.648	Nuclear pore complex protein Nup155
13	9606.ENSP00000274024	0.648	Fatty acid-binding protein, intestinal
14	9606.ENSP00000386170	0.644	T-box transcription factor TBX20
15	9606.ENSP00000400341	0.640	Hepatocyte nuclear factor 3-beta
16	9606.ENSP00000290310	0.615	Potassium voltage-gated channel subfamily E member 2
17	9606.ENSP00000223364	0.613	Myosin regulatory light chain 2, atrial isoform
18	9606.ENSP00000252321	0.609	Potassium voltage-gated channel subfamily A member 5
19	9606.ENSP00000269216	0.594	Transcription factor GATA-6
20	9606.ENSP00000264156	0.580	DNA replication licensing factor MCM6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000987	0.597	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.590	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.992	positive regulation of cellular process
GO:0051173	0.991	positive regulation of nitrogen compound metabolic process
GO:0010604	0.991	positive regulation of macromolecule metabolic process
GO:0009987	0.984	cellular process
GO:0032501	0.980	multicellular organismal process
GO:0080090	0.974	regulation of primary metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0048856	0.955	anatomical structure development
GO:0031325	0.943	positive regulation of cellular metabolic process
GO:0019219	0.935	regulation of nucleobase-containing compound metabolic process
GO:0045944	0.926	positive regulation of transcription by RNA polymerase II
GO:0048513	0.916	animal organ development
GO:0007275	0.911	multicellular organism development
GO:0048731	0.904	system development
GO:0009653	0.846	anatomical structure morphogenesis
GO:0072359	0.793	circulatory system development
GO:0007507	0.745	heart development
GO:0009888	0.706	tissue development
GO:0030154	0.667	cell differentiation
GO:0050896	0.618	response to stimulus
GO:0048519	0.467	negative regulation of biological process
GO:0048523	0.356	negative regulation of cellular process
GO:0051716	0.335	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.990	nucleoplasm
GO:0005737	0.592	cytoplasm
GO:0032991	0.469	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]