StarFunc result for job id Q9BX10

User Input

>input (602 residues)
MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLP
PEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEM
RASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGN
VDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS
DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREH
LGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQ
QFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVP
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALG
DFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEK
IHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANM
GF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UJK4	0.995	0.995	0.000	602	0.988	0.988	Q3UJK4.pdb.gz	GTPB2_MOUSE GTP-binding protein 2 OS=Mus musculus OX=10090 GN=Gtpbp2 PE=1 SV=1
2	AFDB:Q22174	0.897	0.917	1.758E-77	588	0.412	0.422	Q22174.pdb.gz	Q22174_CAEEL Tr-type G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slfl-5 PE=1 SV=1
3	AFDB:D2XV59	0.799	0.722	4.990E-71	669	0.445	0.401	D2XV59.pdb.gz	GTPB1_RAT GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp1 PE=1 SV=1
4	AFDB:Q586X7	0.785	0.592	1.686E-60	805	0.344	0.257	Q586X7.pdb.gz	Q586X7_TRYB2 GTP-binding elongation factor Tu family, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.160 PE=4 SV=1
5	AFDB:P9WNN1	0.557	0.832	1.723E-30	396	0.138	0.210	P9WNN1.pdb.gz	EFTU_MYCTU Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tuf PE=1 SV=1
6	AFDB:Q9ZT91	0.556	0.727	2.154E-30	454	0.154	0.205	Q9ZT91.pdb.gz	EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
7	AFDB:C2E605	0.542	0.808	3.562E-30	396	0.145	0.220	C2E605.pdb.gz	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
8	AFDB:Q9Y700	0.547	0.736	4.709E-30	439	0.141	0.194	Q9Y700.pdb.gz	EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tuf1 PE=3 SV=1
9	AFDB:A0A384ME17	0.566	0.737	8.706E-30	455	0.163	0.215	A0A384ME17.pdb.gz	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
10	AFDB:P23568	0.549	0.820	1.029E-29	394	0.143	0.218	P23568.pdb.gz	EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=tuf PE=1 SV=2
11	PDB:6ji2A	0.544	0.748	1.783E-28	432	0.171	0.238	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
12	PDB:5lzwjj	0.516	0.717	1.922E-25	425	0.169	0.240	5lzwjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
13	PDB:1ob2A	0.536	0.801	9.712E-25	393	0.141	0.216	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
14	PDB:5lztjj	0.527	0.725	1.358E-24	428	0.143	0.201	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
15	PDB:7a5gZ	0.513	0.768	2.654E-24	394	0.156	0.239	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
16	PDB:1xb2A	0.306	0.468	5.487E-24	369	0.156	0.255	1xb2A.pdb.gz
17	PDB:3avtA	0.296	0.170	1.586E-23	1203	0.135	0.067	3avtA.pdb.gz	Molecular basis for RNA polymerization by Q beta replicase
18	PDB:7paj9	0.541	0.808	4.099E-23	393	0.143	0.219	7paj9.pdb.gz	Visualizing translation dynamics at atomic detail inside a bacterial cell.
19	PDB:6ra9B	0.297	0.386	6.409E-23	458	0.154	0.203	6ra9B.pdb.gz	Structural Cues for Understanding eEF1A2 Moonlighting.
20	PDB:2dcuA	0.495	0.707	5.986E-22	407	0.138	0.204	2dcuA.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UJK4	0.0	1221	602	0.988	0.988	GTPB2_MOUSE GTP-binding protein 2 OS=Mus musculus OX=10090 GN=Gtpbp2 PE=1 SV=1
2	Q9BX10	0.0	1234	602	1.000	1.000	GTPB2_HUMAN GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GTPBP2 PE=1 SV=1
3	D2XV59	1.14e-177	520	669	0.445	0.401	GTPB1_RAT GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp1 PE=1 SV=1
4	O00178	3.16e-177	519	669	0.444	0.399	GTPB1_HUMAN GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3
5	Q22174	2.01e-157	466	588	0.395	0.405	Q22174_CAEEL Tr-type G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=slfl-5 PE=1 SV=1
6	Q586X7	5.43e-93	305	805	0.331	0.247	Q586X7_TRYB2 GTP-binding elongation factor Tu family, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.160 PE=4 SV=1
7	Q9P1K2	5.17e-51	172	101	0.141	0.842	Q9P1K2_HUMAN PRO1181 OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q9YAV0	4.26e-20	95.5	437	0.193	0.265	EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=tuf PE=1 SV=1
9	Q9W074	1.20e-14	79.7	670	0.186	0.167	HBS1_DROME Protein HBS1 OS=Drosophila melanogaster OX=7227 GN=HBS1 PE=1 SV=2
10	P14081	4.05e-13	74.7	614	0.136	0.134	SELB_ECOLI Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) OX=83333 GN=selB PE=1 SV=3
11	D9YZV0	7.13e-13	73.9	684	0.159	0.140	D9YZV0_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
12	Q9Y450	7.13e-13	73.9	684	0.159	0.140	HBS1L_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
13	P85834	1.03e-12	72.8	452	0.188	0.250	EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1
14	P62631	1.14e-12	72.8	463	0.164	0.214	EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus OX=10090 GN=Eef1a2 PE=1 SV=1
15	P62632	1.14e-12	72.8	463	0.164	0.214	EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus OX=10116 GN=Eef1a2 PE=1 SV=1
16	Q05639	1.22e-12	72.8	463	0.164	0.214	EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens OX=9606 GN=EEF1A2 PE=1 SV=1
17	Q71V39	1.22e-12	72.8	463	0.164	0.214	EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus OX=9986 GN=EEF1A2 PE=1 SV=1
18	P17506	2.24e-12	71.6	463	0.163	0.212	EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis OX=8355 PE=1 SV=2
19	Q8BFR5	2.58e-12	71.6	452	0.186	0.248	EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1
20	F4KI84	5.67e-12	70.9	668	0.168	0.151	F4KI84_ARATH Translation elongation factor EF1A/initiation factor IF2gamma family protein OS=Arabidopsis thaliana OX=3702 GN=HBS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03029 ATP_bind_1	5.5e+02	11.7	Conserved hypothetical ATP binding protein
2	PF00350 Dynamin_N	83	14.7	Dynamin family
3	PF02421 FeoB_N	7.4e+02	11.1	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	7.8e-22	89.3	Elongation factor Tu GTP binding domain
5	PF03144 GTP_EFTU_D2	0.087	24.5	Elongation factor Tu domain 2
6	PF01926 MMR_HSR1	7.4	18.1	50S ribosome-binding GTPase
7	PF10662 PduV-EutP	45	15.3	Ethanolamine utilisation - propanediol utilisation
8	PF03193 RsgA_GTPase	82	14.5	RsgA GTPase
9	PF09439 SRPRB	2.8e+02	12.3	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004776

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014856	0.638	GRIP and coiled-coil domain containing 1
2	61853.ENSNLEP00000020603	0.637	Protocadherin 7
3	61853.ENSNLEP00000023431	0.637	DDB1 and CUL4 associated factor 17
4	61853.ENSNLEP00000013226	0.620	Protein pelota homolog
5	61853.ENSNLEP00000019377	0.576	Kelch-like family member 1
6	61853.ENSNLEP00000018262	0.569	RALBP1 associated Eps domain containing 1
7	61853.ENSNLEP00000010324	0.545	Lipase maturation factor
8	61853.ENSNLEP00000017367	0.543	Polypeptide N-acetylgalactosaminyltransferase 2
9	61853.ENSNLEP00000014023	0.514	Adaptor-related protein complex 4, mu 1 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.689	heterocyclic compound binding
GO:0097159	0.679	organic cyclic compound binding
GO:0003824	0.645	catalytic activity
GO:0042802	0.603	identical protein binding
GO:0003676	0.460	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0010467	0.986	gene expression
GO:0044248	0.983	cellular catabolic process
GO:0016070	0.983	RNA metabolic process
GO:0050789	0.982	regulation of biological process
GO:0044260	0.981	cellular macromolecule metabolic process
GO:0019538	0.978	protein metabolic process
GO:1901576	0.976	organic substance biosynthetic process
GO:0044249	0.976	cellular biosynthetic process
GO:1901566	0.938	organonitrogen compound biosynthetic process
GO:0044271	0.933	cellular nitrogen compound biosynthetic process
GO:0034645	0.923	cellular macromolecule biosynthetic process
GO:1901575	0.906	organic substance catabolic process
GO:0019222	0.895	regulation of metabolic process
GO:0006412	0.880	translation
GO:0044270	0.858	cellular nitrogen compound catabolic process
GO:1901361	0.854	organic cyclic compound catabolic process
GO:0046700	0.854	heterocycle catabolic process
GO:0019439	0.854	aromatic compound catabolic process
GO:0060255	0.849	regulation of macromolecule metabolic process
GO:0048519	0.807	negative regulation of biological process
GO:0044265	0.801	cellular macromolecule catabolic process
GO:0006414	0.743	translational elongation
GO:0010468	0.732	regulation of gene expression
GO:0006401	0.706	RNA catabolic process
GO:0010605	0.689	negative regulation of macromolecule metabolic process
GO:0010629	0.522	negative regulation of gene expression
GO:0050794	0.504	regulation of cellular process
GO:0016071	0.500	mRNA metabolic process
GO:0000956	0.310	nuclear-transcribed mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0070013	0.998	intracellular organelle lumen
GO:0012505	0.997	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0031982	0.872	vesicle
GO:0005576	0.582	extracellular region
GO:0031410	0.538	cytoplasmic vesicle
GO:0099503	0.430	secretory vesicle
GO:0030141	0.413	secretory granule
GO:0031091	0.369	platelet alpha granule
GO:0005829	0.363	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]