StarFunc result for job id Q9BX26

User Input

>input (1530 residues)
MPIRPDLQQLEKCIDDALRKNDFKPLKTLLQIDICEDVKIKCSKQFFHKVDNLICRELNK
EDIHNVSAILVSVGRCGKNISVLGQAGLLTMIKQGLIQKMVAWFEKSKDIIQSQGNSKDE
AVLNMIEDLVDLLLVIHDVSDEGKKQVVESFVPRICSLVIDSRVNICIQQEIIKKMNAML
DKMPQDARKILSNQEMLILMSSMGERILDAGDYDLQVGIVEALCRMTTEKQRQELAHQWF
SMDFIAKAFKRIKDSEFETDCRIFLNLVNGMLGDKRRVFTFPCLSAFLDKYELQIPSDEK
LEEFWIDFNLGSQTLSFYIAGDNDDHQWEAVTVPEEKVQIYSIEVRESKKLLTIILKNTV
KISKREGKELLLYFDASLEITNVTQKIFGATKHRESIRKQGISVAKTSLHILFDASGSQI
LVPESQISPVGEELVSLKEKSKSPKEFAKPSKYIKNSDKGNRNNSQLEKTTPSKRKMSEA
SMIVSGADRYTMRSPVLFSNTSIPPRRRRIKPPLQMTSSAEKPSVSQTSENRVDNAASLK
SRSSEGRHRRDNIDKHIKTAKCVENTENKNVEFPNQNFSELQDVIPDSQAAEKRDHTILP
GVLDNICGNKIHSKWACWTPVTNIELCNNQRASTSSGDTLNQDIVINKKLTKQKSSSSIS
DHNSEGTGKVKYKKEQTDHIKIDKAEVEVCKKHNQQQNHPKYSGQKNTENAKQSDWPVES
ETTFKSVLLNKTIEESLIYRKKYILSKDVNTATCDKNPSASKNVQSHRKAEKELTSELNS
WDSKQKKMREKSKGKEFTNVAESLISQINKRYKTKDDIKSTRKLKESLINSGFSNKPVVQ
LSKEKVQKKSYRKLKTTFVNVTSECPVNDVYNFNLNGADDPIIKLGIQEFQATAKEACAD
RSIRLVGPRNHDELKSSVKTKDKKIITNHQKKNLFSDTETEYRCDDSKTDISWLREPKSK
PQLIDYSRNKNVKNHKSGKSRSSLEKGQPSSKMTPSKNITKKMDKTIPEGRIRLPRKATK
TKKNYKDLSNSESECEQEFSHSFKENIPVKEENIHSRMKTVKLPKKQQKVFCAETEKELS
KQWKNSSLLKDAIRDNCLDLSPRSLSGSPSSIEVTRCIEKITEKDFTQDYDCITKSISPY
PKTSSLESLNSNSGVGGTIKSPKNNEKNFLCASESCSPIPRPLFLPRHTPTKSNTIVNRK
KISSLVLTQETQNSNSYSDVSSYSSEERFMEIESPHINENYIQSKREESHLASSLSKSSE
GREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKI
EDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKM
LSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFV
DFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDR
LLKDMLEEELLNVRRELMSVFMSHERNANV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70608	0.289	0.294	0.000	1505	0.638	0.649	O70608.pdb.gz	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
2	AFDB:Q9CUU3	0.311	0.317	0.000	1500	0.629	0.642	Q9CUU3.pdb.gz	SYCP2_MOUSE Synaptonemal complex protein 2 OS=Mus musculus OX=10090 GN=Sycp2 PE=1 SV=2
3	AFDB:Q5SYB0	0.078	0.077	1.974E-4	1578	0.101	0.098	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
4	AFDB:Q9VAS9	0.106	0.072	1.194E-3	2417	0.122	0.077	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
5	AFDB:Q9VN82	0.067	0.056	2.011E-3	2051	0.117	0.087	Q9VN82.pdb.gz	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
6	AFDB:Q6PR54	0.079	0.055	2.431E-3	2419	0.137	0.086	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
7	AFDB:D3ZW88	0.073	0.080	2.549E-3	1371	0.101	0.113	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
8	AFDB:A0A0G2JZW4	0.097	0.070	2.672E-3	2308	0.133	0.088	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
9	AFDB:O94913	0.064	0.064	2.802E-3	1555	0.098	0.096	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
10	AFDB:Q04205	0.047	0.043	3.723E-3	1744	0.116	0.102	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
11	PDB:3tpoA	0.104	0.296	3.856E-3	438	0.028	0.098	3tpoA.pdb.gz
12	PDB:5wbjA	0.101	0.137	1.146E-2	1058	0.030	0.043	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
13	PDB:6u3eA	0.088	0.199	1.202E-2	397	0.031	0.118	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
14	PDB:7nkyO	0.047	0.155	1.385E-2	427	0.007	0.026	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
15	PDB:6v8oN	0.094	0.261	1.756E-2	412	0.025	0.092	6v8oN.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
16	PDB:4abnB	0.070	0.157	1.841E-2	426	0.029	0.106	4abnB.pdb.gz
17	PDB:7nkyQ	0.047	0.157	2.122E-2	404	0.008	0.032	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
18	PDB:4ct7B	0.119	0.516	2.333E-2	269	0.015	0.086	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
19	PDB:5voxP	0.100	0.264	2.333E-2	462	0.022	0.071	5voxP.pdb.gz
20	PDB:6wb92	0.059	0.165	2.565E-2	292	0.024	0.123	6wb92.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70608	0.0	1799	1505	0.639	0.649	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
2	Q9CUU3	0.0	1782	1500	0.632	0.645	SYCP2_MOUSE Synaptonemal complex protein 2 OS=Mus musculus OX=10090 GN=Sycp2 PE=1 SV=2
3	K7N7B3	4.02e-81	288	811	0.103	0.195	K7N7B3_HUMAN Synaptonemal complex protein 2 like (Fragment) OS=Homo sapiens OX=9606 GN=SYCP2L PE=1 SV=1
4	Q5T4T6	4.42e-81	288	812	0.103	0.195	SYC2L_HUMAN Synaptonemal complex protein 2-like OS=Homo sapiens OX=9606 GN=SYCP2L PE=1 SV=2
5	A0A0M3U1B0	2.20e-72	262	842	0.099	0.181	SYC2L_MOUSE Synaptonemal complex protein 2-like OS=Mus musculus OX=10090 GN=Sycp2l PE=2 SV=1
6	Q63520	0.004	43.1	257	0.020	0.121	SYCP3_RAT Synaptonemal complex protein 3 OS=Rattus norvegicus OX=10116 GN=Sycp3 PE=1 SV=1
7	P70281	0.018	41.2	254	0.020	0.118	SYCP3_MOUSE Synaptonemal complex protein 3 OS=Mus musculus OX=10090 GN=Sycp3 PE=1 SV=1
8	Q8ILP3	1.3	36.2	969	0.024	0.038	P113_PLAF7 Surface protein P113 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=P113 PE=1 SV=1
9	A7GBG3	2.4	35.4	1278	0.018	0.021	BXF_CLOBL Botulinum neurotoxin type F OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=F PE=1 SV=1
10	Q57236	2.4	35.4	1278	0.018	0.021	Q57236_CLOBO Botulinum neurotoxin type F OS=Clostridium botulinum OX=1491 GN=F PE=1 SV=1
11	Q62057	3.3	33.9	209	0.018	0.129	Q62057_MOUSE Pregnancy-specific glycoprotein (Fragment) OS=Mus musculus OX=10090 GN=Psg18 PE=2 SV=1
12	Q585C9	6.9	33.9	1271	0.018	0.021	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1
13	B2RSG7	9.4	33.1	476	0.018	0.057	B2RSG7_MOUSE Pregnancy specific beta-1-glycoprotein 18 OS=Mus musculus OX=10090 GN=Psg18 PE=2 SV=1
14	G5EAW7	9.4	33.1	561	0.017	0.046	G5EAW7_EMENI amidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03957 PE=3 SV=1
15	Q9R038	9.5	33.1	476	0.018	0.057	Q9R038_MOUSE Pregnancy specific glycoprotein 18 OS=Mus musculus OX=10090 GN=Psg18 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18581 SYCP2_ARLD	1.8e-66	234.8	Synaptonemal complex 2 armadillo-repeat-like domain
2	PF18584 SYCP2_SLD	2.5e-40	148.6	Synaptonemal complex 2 Spt16M-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376658	0.998	Synaptonemal complex protein 3
2	9606.ENSP00000358535	0.983	Synaptonemal complex protein 1
3	9606.ENSP00000379226	0.931	Testis-expressed protein 11
4	9606.ENSP00000293695	0.923	Synaptonemal complex central element protein 2
5	9606.ENSP00000280358	0.921	Testis-expressed protein 12
6	9606.ENSP00000385480	0.921	Synaptonemal complex central element protein 3
7	9606.ENSP00000482546	0.920	Meiotic recombination protein REC8 homolog
8	9606.ENSP00000341282	0.907	Synaptonemal complex central element protein 1
9	9606.ENSP00000354720	0.897	Structural maintenance of chromosomes protein 3
10	9606.ENSP00000477973	0.896	Cohesin subunit SA-3
11	9606.ENSP00000350036	0.886	Structural maintenance of chromosomes protein 1B
12	9606.ENSP00000360310	0.811	Meiotic recombination protein SPO11
13	9606.ENSP00000372689	0.795	Cohesin subunit SA-1
14	9606.ENSP00000297338	0.793	Double-strand-break repair protein rad21 homolog
15	9606.ENSP00000355167	0.793	HORMA domain-containing protein 1
16	9606.ENSP00000353920	0.777	Double-stranded RNA-specific editase 1
17	9606.ENSP00000323421	0.774	Structural maintenance of chromosomes protein 1A
18	9606.ENSP00000336984	0.770	HORMA domain-containing protein 2
19	9606.ENSP00000386414	0.739	Double-strand-break repair protein rad21-like protein 1
20	9606.ENSP00000252037	0.737	Inactive peptidyl-prolyl cis-trans isomerase FKBP6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.319	organic cyclic compound binding
GO:1901363	0.314	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0000003	0.978	reproduction
GO:0050789	0.970	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0022402	0.957	cell cycle process
GO:0016043	0.956	cellular component organization
GO:0006996	0.954	organelle organization
GO:0048523	0.927	negative regulation of cellular process
GO:0022414	0.884	reproductive process
GO:0048285	0.806	organelle fission
GO:0000280	0.802	nuclear division
GO:0032502	0.685	developmental process
GO:0051321	0.562	meiotic cell cycle
GO:1903046	0.492	meiotic cell cycle process
GO:0032501	0.476	multicellular organismal process
GO:0140013	0.467	meiotic nuclear division
GO:0019953	0.437	sexual reproduction
GO:0048609	0.435	multicellular organismal reproductive process
GO:0007276	0.434	gamete generation
GO:0003006	0.422	developmental process involved in reproduction
GO:0048232	0.389	male gamete generation
GO:0048856	0.378	anatomical structure development
GO:0019222	0.364	regulation of metabolic process
GO:0008152	0.338	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000795	0.996	synaptonemal complex
GO:0000800	0.976	lateral element
GO:0005737	0.813	cytoplasm
GO:0005829	0.365	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]