StarFunc result for job id Q9BX40

User Input

>input (385 residues)
MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPR
EEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGM
APYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGT
TGTQLNGRQAQPSSKTASDVVQPAAVQAQGQVNDENRRPQRRRSGNRRTRNRSRGQNRPT
NVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDDKAEKGEEKDLAVVTQSAEAP
AEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSGRFLRGRSSRG
GFRGGRGNGTTRRNPTSHRAGTGRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BX40	0.999	0.999	1.552E-57	385	1.000	1.000	Q9BX40.pdb.gz	LS14B_HUMAN Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1
2	AFDB:Q498K9	0.300	0.302	2.138E-43	380	0.782	0.792	Q498K9.pdb.gz	L14BB_XENLA Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1
3	AFDB:Q7ZVT0	0.236	0.238	5.118E-33	382	0.574	0.579	Q7ZVT0.pdb.gz
4	AFDB:M9PF20	0.209	0.127	1.017E-17	657	0.423	0.248	M9PF20.pdb.gz	M9PF20_DROME Trailer hitch, isoform H OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
5	AFDB:Q9HGL3	0.197	0.179	4.221E-17	426	0.322	0.291	Q9HGL3.pdb.gz	SUM2_SCHPO Protein sum2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sum2 PE=1 SV=1
6	AFDB:Q9C658	0.218	0.143	1.481E-15	611	0.358	0.226	Q9C658.pdb.gz	DCP5_ARATH Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
7	AFDB:Q5AXT7	0.149	0.084	3.118E-6	698	0.166	0.092	Q5AXT7.pdb.gz	Q5AXT7_EMENI Enhancer of mRNA-decapping protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06893 PE=3 SV=1
8	PDB:3jb9E	0.154	0.561	3.305E-5	98	0.057	0.224	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
9	PDB:5vsuF	0.155	0.675	4.445E-5	77	0.031	0.156	5vsuF.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
10	PDB:6exnr	0.165	0.738	6.345E-5	75	0.039	0.200	6exnr.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
11	PDB:7w59b	0.166	0.561	7.144E-5	102	0.047	0.176	7w59b.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:3jcmh	0.156	0.717	9.056E-5	77	0.042	0.208	3jcmh.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
13	PDB:3swnQ	0.151	0.718	1.020E-4	73	0.036	0.192	3swnQ.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
14	PDB:3pgwW	0.147	0.553	1.148E-4	92	0.036	0.152	3pgwW.pdb.gz
15	PDB:3jb9D	0.148	0.547	1.218E-4	96	0.034	0.135	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:5nrll	0.143	0.517	1.544E-4	99	0.031	0.121	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:6g90d	0.151	0.577	1.739E-4	93	0.062	0.258	6g90d.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	AFDB:G8B7A0	0.087	0.087	2.298E-1	385	0.096	0.096	G8B7A0.pdb.gz	G8B7A0_CANPC BZIP domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=HAC1 PE=3 SV=1
19	AFDB:P24054	0.093	0.066	2.588E-1	634	0.148	0.090	P24054.pdb.gz	SPRL1_RAT SPARC-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sparcl1 PE=1 SV=1
20	AFDB:Q3TGQ4	0.073	0.042	2.588E-1	858	0.132	0.059	Q3TGQ4.pdb.gz	Q3TGQ4_MOUSE Ribosomal protein eL8/eL30/eS12/Gadd45 domain-containing protein OS=Mus musculus OX=10090 GN=Secisbp2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q498K9	0.0	516	380	0.784	0.795	L14BB_XENLA Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1
2	Q9BX40	0.0	788	385	1.000	1.000	LS14B_HUMAN Protein LSM14 homolog B OS=Homo sapiens OX=9606 GN=LSM14B PE=1 SV=1
3	Q68FI1	3.06e-173	491	422	0.771	0.704	L14BA_XENLA Protein LSM14 homolog B-A OS=Xenopus laevis OX=8355 GN=lsm14b-a PE=1 SV=1
4	F1Q898	4.64e-128	375	380	0.558	0.566	F1Q898_DANRE LSM family member 14B OS=Danio rerio OX=7955 GN=zgc:55673 PE=1 SV=1
5	A8E580	7.83e-128	374	380	0.558	0.566	A8E580_DANRE Zgc:55673 protein OS=Danio rerio OX=7955 GN=lsm14b PE=2 SV=1
6	Q8ND56	1.91e-103	315	463	0.543	0.451	LS14A_HUMAN Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3
7	Q8K2F8	3.36e-98	301	462	0.566	0.472	LS14A_MOUSE Protein LSM14 homolog A OS=Mus musculus OX=10090 GN=Lsm14a PE=1 SV=1
8	A0A8M2	7.50e-93	288	471	0.517	0.423	L14AA_XENLA Protein LSM14 homolog A-A OS=Xenopus laevis OX=8355 GN=lsm14a-a PE=1 SV=1
9	Q9YH12	7.38e-88	275	467	0.494	0.407	LSM14_PLEWA Protein LSM14 homolog OS=Pleurodeles waltl OX=8319 GN=lsm14 PE=1 SV=1
10	Q9XW17	1.03e-37	140	340	0.179	0.203	LS14H_CAEEL Protein LSM14 homolog car-1 OS=Caenorhabditis elegans OX=6239 GN=car-1 PE=1 SV=1
11	M9PCB7	2.09e-28	119	643	0.158	0.095	M9PCB7_DROME Trailer hitch, isoform G OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
12	M9PFB2	2.27e-28	119	642	0.158	0.095	M9PFB2_DROME Trailer hitch, isoform E OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
13	Q9VTZ0	2.35e-28	119	652	0.158	0.094	Q9VTZ0_DROME GH08269p OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=3
14	M9PFG3	2.37e-28	119	647	0.158	0.094	M9PFG3_DROME Trailer hitch, isoform I OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
15	M9PI44	2.43e-28	119	653	0.158	0.093	M9PI44_DROME Trailer hitch, isoform F OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
16	M9PFF9	2.55e-28	119	646	0.158	0.094	M9PFF9_DROME Trailer hitch, isoform D OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
17	M9PF14	2.56e-28	119	656	0.158	0.093	M9PF14_DROME Trailer hitch, isoform C OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
18	M9PF20	2.57e-28	119	657	0.158	0.093	M9PF20_DROME Trailer hitch, isoform H OS=Drosophila melanogaster OX=7227 GN=tral PE=1 SV=1
19	Q9C658	8.66e-25	108	611	0.145	0.092	DCP5_ARATH Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
20	P45978	6.37e-18	86.3	349	0.242	0.266	SCD6_YEAST Protein SCD6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCD6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09532 FDF	1.3e-21	88.8	FDF domain
2	PF12701 LSM14	1.5e-26	103.6	Scd6-like Sm domain
3	PF14438 SM-ATX	4.2e-05	35.0	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478754	0.991	Probable ATP-dependent RNA helicase DDX6
2	9606.ENSP00000373715	0.924	m7GpppN-mRNA hydrolase
3	9606.ENSP00000476046	0.905	mRNA-decapping enzyme 1A
4	9606.ENSP00000323714	0.894	Eukaryotic translation initiation factor 4E type 1B
5	9606.ENSP00000280665	0.867	mRNA-decapping enzyme 1B
6	9606.ENSP00000380659	0.824	Eukaryotic translation initiation factor 4E transporter
7	9606.ENSP00000320503	0.821	Enhancer of mRNA-decapping protein 3
8	9606.ENSP00000362993	0.809	Protein bicaudal C homolog 1
9	9606.ENSP00000255136	0.793	Polyadenylate-binding protein 1-like
10	9606.ENSP00000300146	0.793	Protein PAT1 homolog 1
11	9606.ENSP00000416673	0.780	Protein PAT1 homolog 2
12	9606.ENSP00000264951	0.724	5'-3' exoribonuclease 1
13	9606.ENSP00000310596	0.708	U6 snRNA-associated Sm-like protein LSm1
14	9606.ENSP00000402338	0.669	Ribosome production factor 2 homolog
15	9606.ENSP00000425561	0.655	Eukaryotic translation initiation factor 4E
16	9606.ENSP00000378917	0.633	Ataxin-2-like protein
17	9606.ENSP00000250113	0.632	Fragile X mental retardation syndrome-related protein 2
18	9606.ENSP00000351811	0.622	Enhancer of mRNA-decapping protein 4
19	9606.ENSP00000382840	0.607	ATP-dependent RNA helicase DDX3X
20	9606.ENSP00000364813	0.597	U6 snRNA-associated Sm-like protein LSm2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0080090	0.992	regulation of primary metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0009987	0.990	cellular process
GO:0010556	0.983	regulation of macromolecule biosynthetic process
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0010468	0.941	regulation of gene expression
GO:2000112	0.839	regulation of cellular macromolecule biosynthetic process
GO:0048519	0.768	negative regulation of biological process
GO:0010608	0.756	post-transcriptional regulation of gene expression
GO:0051246	0.725	regulation of protein metabolic process
GO:0006417	0.695	regulation of translation
GO:0071704	0.584	organic substance metabolic process
GO:0009892	0.511	negative regulation of metabolic process
GO:0010605	0.503	negative regulation of macromolecule metabolic process
GO:0051172	0.477	negative regulation of nitrogen compound metabolic process
GO:0043170	0.474	macromolecule metabolic process
GO:0044237	0.471	cellular metabolic process
GO:0048523	0.465	negative regulation of cellular process
GO:0044238	0.460	primary metabolic process
GO:0048518	0.453	positive regulation of biological process
GO:0034641	0.450	cellular nitrogen compound metabolic process
GO:0071840	0.449	cellular component organization or biogenesis
GO:0010629	0.435	negative regulation of gene expression
GO:0031324	0.434	negative regulation of cellular metabolic process
GO:0048522	0.405	positive regulation of cellular process
GO:0051248	0.352	negative regulation of protein metabolic process
GO:2000113	0.319	negative regulation of cellular macromolecule biosynthetic process
GO:0034249	0.316	negative regulation of amide metabolic process
GO:0017148	0.310	negative regulation of translation
GO:1901360	0.306	organic cyclic compound metabolic process
GO:0016043	0.301	cellular component organization
GO:0044085	0.300	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.990	cytoplasm
GO:0032991	0.987	protein-containing complex
GO:1990904	0.979	ribonucleoprotein complex
GO:0005829	0.943	cytosol
GO:0043232	0.928	intracellular non-membrane-bounded organelle
GO:0005634	0.799	nucleus
GO:0036464	0.551	cytoplasmic ribonucleoprotein granule
GO:0016020	0.501	membrane
GO:0070013	0.493	intracellular organelle lumen
GO:0031981	0.470	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]