StarFunc result for job id Q9BX46

User Input

>input (236 residues)
MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA
DRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAH
YVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAA
SPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8KAI7	0.405	0.405	3.219E-35	236	1.000	1.000	A8KAI7.pdb.gz	A8KAI7_HUMAN RNA binding motif protein 24, isoform CRA_a OS=Homo sapiens OX=9606 GN=RBM24 PE=2 SV=1
2	AFDB:Q76LC6	0.417	0.427	5.751E-32	230	0.839	0.861	Q76LC6.pdb.gz	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
3	AFDB:E9QCG4	0.472	0.456	2.764E-27	245	0.775	0.747	E9QCG4.pdb.gz	E9QCG4_DANRE RNA-binding motif protein 24b OS=Danio rerio OX=7955 GN=zgc:136803 PE=4 SV=1
4	AFDB:Q9H0Z9	0.449	0.444	3.655E-26	239	0.678	0.669	Q9H0Z9.pdb.gz	RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens OX=9606 GN=RBM38 PE=1 SV=2
5	AFDB:F4HUQ5	0.441	0.386	9.404E-18	274	0.398	0.343	F4HUQ5.pdb.gz	F4HUQ5_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g20880 PE=1 SV=1
6	AFDB:O45189	0.412	0.393	1.070E-17	248	0.458	0.435	O45189.pdb.gz	O45189_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
7	AFDB:F4I2E4	0.372	0.310	1.832E-16	285	0.381	0.316	F4I2E4.pdb.gz	F4I2E4_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g76460 PE=1 SV=1
8	AFDB:Q67YS0	0.366	0.353	3.975E-16	245	0.356	0.343	Q67YS0.pdb.gz	Q67YS0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33470 PE=1 SV=1
9	AFDB:F4I321	0.376	0.259	1.871E-15	347	0.314	0.213	F4I321.pdb.gz	F4I321_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22910 PE=1 SV=1
10	AFDB:Q8LF90	0.385	0.318	2.940E-15	287	0.322	0.265	Q8LF90.pdb.gz	Q8LF90_ARATH At1g78260 OS=Arabidopsis thaliana OX=3702 GN=At1g78260 PE=1 SV=1
11	PDB:6qx91K	0.343	0.400	8.143E-9	201	0.131	0.154	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:6g90B	0.326	0.396	6.024E-8	193	0.148	0.181	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
13	PDB:7dvqY	0.306	0.508	3.227E-7	140	0.114	0.193	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6n7pA	0.323	0.406	3.442E-7	186	0.127	0.161	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
15	PDB:5yzg1	0.313	0.304	5.408E-7	243	0.110	0.107	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:7ohxo	0.304	0.605	1.173E-6	112	0.106	0.223	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
17	PDB:6c0fo	0.311	0.533	1.620E-6	133	0.123	0.218	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
18	PDB:6y53o	0.310	0.450	1.729E-6	160	0.102	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:6gd1A	0.300	0.370	2.098E-6	190	0.093	0.116	6gd1A.pdb.gz
20	PDB:6zmwo	0.296	0.848	2.098E-6	77	0.093	0.286	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8KAI7	4.04e-167	462	236	1.000	1.000	A8KAI7_HUMAN RNA binding motif protein 24, isoform CRA_a OS=Homo sapiens OX=9606 GN=RBM24 PE=2 SV=1
2	Q9BX46	4.04e-167	462	236	1.000	1.000	RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1
3	D3Z4I3	2.05e-165	457	236	0.987	0.987	RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus OX=10090 GN=Rbm24 PE=1 SV=1
4	M0R7T6	1.03e-164	456	236	0.983	0.983	RBM24_RAT RNA-binding protein 24 OS=Rattus norvegicus OX=10116 GN=Rbm24 PE=3 SV=4
5	Q6GQD3	2.05e-122	348	225	0.864	0.907	RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis OX=8355 GN=rbm24-a PE=2 SV=1
6	Q76LC6	2.69e-116	333	230	0.809	0.830	RBM24_DANRE RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1
7	Q5ZMA3	1.68e-112	323	225	0.877	0.920	RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus OX=9031 GN=RBM24 PE=1 SV=2
8	Q9H0Z9	3.21e-100	293	239	0.678	0.669	RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens OX=9606 GN=RBM38 PE=1 SV=2
9	E9QCG4	8.31e-97	284	245	0.758	0.731	E9QCG4_DANRE RNA-binding motif protein 24b OS=Danio rerio OX=7955 GN=zgc:136803 PE=4 SV=1
10	H0Y8S7	1.44e-86	257	201	0.780	0.915	H0Y8S7_HUMAN RNA binding motif protein 24 (Fragment) OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1
11	Q62176	3.45e-86	257	237	0.682	0.679	RBM38_MOUSE RNA-binding protein 38 OS=Mus musculus OX=10090 GN=Rbm38 PE=1 SV=2
12	O45189	6.57e-52	170	248	0.466	0.444	O45189_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
13	H2L051	1.15e-51	166	151	0.314	0.490	H2L051_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-12 PE=1 SV=1
14	F4HUQ5	1.32e-34	126	274	0.360	0.310	F4HUQ5_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g20880 PE=1 SV=1
15	Q67YS0	2.18e-33	122	245	0.246	0.237	Q67YS0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g33470 PE=1 SV=1
16	F4I2E4	4.46e-33	122	285	0.237	0.196	F4I2E4_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g76460 PE=1 SV=1
17	Q501B0	2.42e-32	122	336	0.242	0.170	Q501B0_ARATH At2g46780 OS=Arabidopsis thaliana OX=3702 GN=At2g46780 PE=1 SV=1
18	Q9LME7	7.14e-32	119	291	0.233	0.189	Q9LME7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22330 PE=1 SV=1
19	Q8LF90	7.85e-32	119	287	0.220	0.181	Q8LF90_ARATH At1g78260 OS=Arabidopsis thaliana OX=3702 GN=At1g78260 PE=1 SV=1
20	F4I321	3.32e-29	114	347	0.216	0.147	F4I321_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22910 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08669 GCV_T_C	1.7e+02	13.5	Glycine cleavage T-protein C-terminal barrel domain
2	PF14605 Nup35_RRM_2	1.3e+02	14.0	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	8.5e-14	62.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	0.82	21.1	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000004689

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000016940	0.778	RNA binding protein, fox-1 homolog (C. elegans) 2
2	132908.ENSPVAP00000012705	0.749	RNA binding protein, fox-1 homolog (C. elegans) 1
3	132908.ENSPVAP00000014368	0.749	RNA binding protein, fox-1 homolog (C. elegans) 3
4	132908.ENSPVAP00000002226	0.747	Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
5	132908.ENSPVAP00000010650	0.723	Transformer 2 alpha homolog (Drosophila)
6	132908.ENSPVAP00000008134	0.716	Transformer 2 beta homolog (Drosophila)
7	132908.ENSPVAP00000012084	0.704	RNA binding motif protein 42
8	132908.ENSPVAP00000002175	0.697	ELAV like RNA binding protein 1
9	132908.ENSPVAP00000006381	0.697	Cleavage and polyadenylation specific factor 1, 160kDa
10	132908.ENSPVAP00000007878	0.697	Cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa
11	132908.ENSPVAP00000013971	0.695	Sigma non-opioid intracellular receptor 1
12	132908.ENSPVAP00000015687	0.690	RNA binding protein with multiple splicing 2
13	132908.ENSPVAP00000005164	0.663	PCF11 cleavage and polyadenylation factor subunit
14	132908.ENSPVAP00000004001	0.662	Cleavage and polyadenylation specific factor 2, 100kDa
15	132908.ENSPVAP00000005931	0.657	Cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
16	132908.ENSPVAP00000015978	0.648	Splicing factor 1
17	132908.ENSPVAP00000003320	0.642	Zinc finger CCCH-type containing 8
18	132908.ENSPVAP00000005378	0.642	Zinc finger CCCH-type containing 4
19	132908.ENSPVAP00000006359	0.642	Cleavage and polyadenylation specific factor 4-like
20	132908.ENSPVAP00000007108	0.642	Cleavage and polyadenylation specific factor 4, 30kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051252	0.991	regulation of RNA metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0050684	0.979	regulation of mRNA processing
GO:0043484	0.976	regulation of RNA splicing
GO:0048024	0.973	regulation of mRNA splicing, via spliceosome
GO:0009987	0.963	cellular process
GO:0000381	0.957	regulation of alternative mRNA splicing, via spliceosome
GO:0045595	0.866	regulation of cell differentiation
GO:0051147	0.827	regulation of muscle cell differentiation
GO:0048518	0.789	positive regulation of biological process
GO:0048522	0.733	positive regulation of cellular process
GO:0051153	0.694	regulation of striated muscle cell differentiation
GO:0008152	0.690	metabolic process
GO:0006807	0.679	nitrogen compound metabolic process
GO:0044237	0.675	cellular metabolic process
GO:0010830	0.672	regulation of myotube differentiation
GO:0071704	0.637	organic substance metabolic process
GO:0044238	0.616	primary metabolic process
GO:0043170	0.563	macromolecule metabolic process
GO:0045597	0.544	positive regulation of cell differentiation
GO:0034641	0.503	cellular nitrogen compound metabolic process
GO:0048519	0.441	negative regulation of biological process
GO:0048523	0.419	negative regulation of cellular process
GO:0009893	0.416	positive regulation of metabolic process
GO:0006139	0.388	nucleobase-containing compound metabolic process
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0010608	0.383	post-transcriptional regulation of gene expression
GO:0009894	0.377	regulation of catabolic process
GO:0090304	0.376	nucleic acid metabolic process
GO:0010605	0.371	negative regulation of macromolecule metabolic process
GO:0016070	0.368	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.947	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]