StarFunc result for job id Q9BX63

User Input

>input (1249 residues)
MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSA
LAWQQSLSGKPADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNG
TSSTCQDSPEKTTLAAKLSAKKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEV
HNLDAKVDSGKTVKLNSPLEKINSFSPQKPPGHCSRCCCSTKQGNSQESSNTIKKDHTGK
SKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCME
LLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQ
DADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD
ELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKM
GITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQ
NSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAF
SDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNL
CATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELV
KTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVI
TIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG
ALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRT
NIQDNESTLEVTSLKYSTSPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPS
SIISRKEKNDPVFLEEAGKAEKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKAT
PELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKID
ATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPELYDPE
DTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDCIDTKLNGILH
IEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K475	0.662	0.708	0.000	1166	0.693	0.743	A0A0G2K475.pdb.gz	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
2	AFDB:Q3YK19	0.604	0.602	0.000	1252	0.556	0.555	Q3YK19.pdb.gz	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
3	AFDB:Q5SXJ3	0.640	0.679	0.000	1174	0.699	0.744	Q5SXJ3.pdb.gz	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
4	AFDB:Q9BX63	0.999	0.999	0.000	1249	1.000	1.000	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
5	PDB:7ad8B	0.455	0.814	8.760E-37	675	0.139	0.258	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
6	PDB:7lbmX	0.448	0.715	1.489E-34	760	0.139	0.229	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
7	PDB:7k010	0.413	0.663	1.530E-33	754	0.122	0.203	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
8	PDB:5fmfY	0.347	0.692	5.333E-26	578	0.093	0.201	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
9	PDB:5svaY	0.325	0.660	6.091E-25	562	0.098	0.219	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
10	PDB:6fwrA	0.324	0.541	1.280E-22	699	0.086	0.153	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
11	PDB:3crvA	0.285	0.578	2.910E-21	551	0.088	0.200	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
12	PDB:3crw1	0.258	0.588	1.096E-16	485	0.076	0.196	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
13	PDB:2vdaA	0.174	0.248	7.819E-6	828	0.060	0.091	2vdaA.pdb.gz	Structural Basis for Signal-Sequence Recognition by the Translocase Motor Seca as Determined by NMR
14	PDB:6goxA	0.157	0.231	9.663E-6	777	0.058	0.093	6goxA.pdb.gz
15	AFDB:Q8T145	0.137	0.106	1.791E-5	1789	0.118	0.083	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
16	AFDB:Q9Y4B4	0.153	0.133	1.570E-4	1467	0.133	0.113	Q9Y4B4.pdb.gz	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
17	AFDB:A0A0B4KF25	0.070	0.076	1.085E-2	1131	0.101	0.111	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
18	AFDB:B9F1C0	0.065	0.054	1.144E-2	1709	0.139	0.102	B9F1C0.pdb.gz	SHOC1_ORYSJ Protein SHORTAGE IN CHIASMATA 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SHOC1 PE=1 SV=1
19	AFDB:O88917	0.056	0.051	2.160E-2	1515	0.118	0.098	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
20	AFDB:O60184	0.051	0.056	5.601E-2	1102	0.103	0.117	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K475	0.0	1749	1166	0.695	0.744	A0A0G2K475_RAT BRCA1 interacting protein C-terminal helicase 1 OS=Rattus norvegicus OX=10116 GN=Brip1 PE=1 SV=1
2	Q3YK19	0.0	1291	1252	0.564	0.563	FANCJ_CHICK Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1
3	Q5SXJ3	0.0	1782	1174	0.701	0.745	FANCJ_MOUSE Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1
4	Q9BX63	0.0	2605	1249	1.000	1.000	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
5	F4HUN4	3.08e-160	512	1175	0.219	0.233	F4HUN4_ARATH RAD3-like DNA-binding helicase protein OS=Arabidopsis thaliana OX=3702 GN=At1g20720 PE=1 SV=1
6	O62217	1.40e-111	375	983	0.189	0.240	O62217_CAEEL DNA helicase OS=Caenorhabditis elegans OX=6239 GN=dog-1 PE=1 SV=1
7	Q9W484	1.31e-102	351	985	0.182	0.230	RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Rtel1 PE=1 SV=1
8	F4HQE2	1.75e-95	332	1040	0.175	0.210	RTEL1_ARATH Regulator of telomere elongation helicase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=RTEL1 PE=3 SV=1
9	Q93575	1.91e-78	282	994	0.165	0.207	RTEL1_CAEEL Regulator of telomere elongation helicase 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rtel-1 PE=3 SV=3
10	F1R345	8.65e-73	263	890	0.152	0.213	DDX11_DANRE ATP-dependent DNA helicase DDX11 OS=Danio rerio OX=7955 GN=ddx11 PE=2 SV=1
11	A8MPP1	1.64e-66	245	907	0.152	0.209	D11L8_HUMAN Putative ATP-dependent RNA helicase DDX11-like protein 8 OS=Homo sapiens OX=9606 GN=DDX11L8 PE=1 SV=1
12	Q0VGM9	2.32e-63	238	1203	0.102	0.106	RTEL1_MOUSE Regulator of telomere elongation helicase 1 OS=Mus musculus OX=10090 GN=Rtel1 PE=1 SV=2
13	Q9NZ71	1.46e-61	233	1219	0.095	0.098	RTEL1_HUMAN Regulator of telomere elongation helicase 1 OS=Homo sapiens OX=9606 GN=RTEL1 PE=1 SV=2
14	O14147	3.19e-59	222	844	0.148	0.219	CHL1_SCHPO ATP-dependent DNA helicase chl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chl1 PE=3 SV=1
15	Q96FC9	4.20e-55	211	970	0.131	0.169	DDX11_HUMAN ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11 PE=1 SV=1
16	P22516	1.89e-51	198	861	0.147	0.213	CHL1_YEAST ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHL1 PE=1 SV=1
17	A0A1D8PQH0	2.42e-44	175	765	0.142	0.231	A0A1D8PQH0_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD3 PE=3 SV=1
18	A8MX75	8.70e-44	173	706	0.135	0.239	A8MX75_HUMAN General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Homo sapiens OX=9606 GN=ERCC2 PE=1 SV=2
19	O08811	1.68e-43	173	760	0.139	0.228	ERCC2_MOUSE General transcription and DNA repair factor IIH helicase subunit XPD OS=Mus musculus OX=10090 GN=Ercc2 PE=1 SV=2
20	P26659	2.86e-43	172	772	0.137	0.222	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	0.02	26.2	DEAD/DEAH box helicase
2	PF06733 DEAD_2	3.1e-50	181.7	DEAD_2
3	PF15992 DUF4769	49	15.2	Domain of unknown function (DUF4769)
4	PF06777 HBB	1.6e+02	13.4	Helical and beta-bridge domain
5	PF13307 Helicase_C_2	5.9e-51	184.5	Helicase C-terminal domain
6	PF04851 ResIII	0.73	21.3	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
2	9606.ENSP00000260810	0.994	DNA topoisomerase 2-binding protein 1
3	9606.ENSP00000231790	0.992	DNA mismatch repair protein Mlh1
4	9606.ENSP00000412698	0.985	MMS19 nucleotide excision repair protein homolog
5	9606.ENSP00000347232	0.981	Bloom syndrome protein
6	9606.ENSP00000265849	0.980	Mismatch repair endonuclease PMS2
7	9606.ENSP00000261584	0.975	Partner and localizer of BRCA2
8	9606.ENSP00000369497	0.972	Breast cancer type 2 susceptibility protein
9	9606.ENSP00000260947	0.965	BRCA1-associated RING domain protein 1
10	9606.ENSP00000294008	0.963	Structure-specific endonuclease subunit SLX4
11	9606.ENSP00000307853	0.963	Crossover junction endonuclease MUS81
12	9606.ENSP00000457353	0.959	Probable crossover junction endonuclease EME2
13	9606.ENSP00000310520	0.953	DNA repair endonuclease XPF
14	9606.ENSP00000418287	0.953	Probable cytosolic iron-sulfur protein assembly protein CIAO1
15	9606.ENSP00000387471	0.950	Mitotic spindle-associated MMXD complex subunit MIP18
16	9606.ENSP00000013807	0.943	DNA excision repair protein ERCC-1
17	9606.ENSP00000442336	0.943	DNA topoisomerase 3-alpha
18	9606.ENSP00000318977	0.942	Flap endonuclease GEN homolog 1
19	9606.ENSP00000283027	0.941	Cytosolic Fe-S cluster assembly factor NUBP1
20	9606.ENSP00000251588	0.939	Cytosolic Fe-S cluster assembly factor NARFL

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043139	0.995	5'-3' DNA helicase activity
GO:1901363	0.419	heterocyclic compound binding
GO:0097159	0.419	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0019222	0.973	regulation of metabolic process
GO:0009987	0.968	cellular process
GO:0050896	0.959	response to stimulus
GO:0051716	0.942	cellular response to stimulus
GO:0050794	0.942	regulation of cellular process
GO:0006950	0.926	response to stress
GO:0033554	0.922	cellular response to stress
GO:0060255	0.914	regulation of macromolecule metabolic process
GO:0071704	0.838	organic substance metabolic process
GO:0044237	0.832	cellular metabolic process
GO:0044238	0.831	primary metabolic process
GO:0006807	0.818	nitrogen compound metabolic process
GO:0043170	0.817	macromolecule metabolic process
GO:0090304	0.787	nucleic acid metabolic process
GO:0044260	0.780	cellular macromolecule metabolic process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0006974	0.749	cellular response to DNA damage stimulus
GO:0006259	0.732	DNA metabolic process
GO:0080090	0.697	regulation of primary metabolic process
GO:0031323	0.691	regulation of cellular metabolic process
GO:0019219	0.681	regulation of nucleobase-containing compound metabolic process
GO:0006281	0.580	DNA repair
GO:0010468	0.412	regulation of gene expression
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0012505	0.919	endomembrane system
GO:0016020	0.906	membrane
GO:0140513	0.839	nuclear protein-containing complex
GO:0043232	0.747	intracellular non-membrane-bounded organelle
GO:0031967	0.594	organelle envelope
GO:0031090	0.569	organelle membrane
GO:0005694	0.413	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.995	DNA 5'-3' helicase.

[back to server]