StarFunc result for job id Q9BX66

User Input

>input (1292 residues)
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
LTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAK
DDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQP
GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
KTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHA
VKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
LNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQV
DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHS
KLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDH
LALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGV
HTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGP
GGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGE
QAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BX66	1.000	1.000	0.000	1292	1.000	1.000	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
2	AFDB:Q62417	0.123	0.123	3.648E-59	1290	0.554	0.555	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
3	AFDB:O35413	0.075	0.080	9.854E-27	1196	0.201	0.217	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
4	AFDB:A0A0U1RQE4	0.084	0.101	2.126E-15	1047	0.144	0.178	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
5	AFDB:A0A494C1M0	0.088	0.109	7.055E-14	1011	0.146	0.186	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
6	PDB:1griA	0.047	0.255	2.232E-8	211	0.037	0.227	1griA.pdb.gz
7	PDB:2lqnA	0.048	0.179	1.360E-7	303	0.029	0.125	2lqnA.pdb.gz
8	PDB:2eyzA	0.060	0.192	8.775E-7	304	0.033	0.138	2eyzA.pdb.gz
9	AFDB:Q13387	0.056	0.081	1.234E-5	824	0.107	0.167	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
10	PDB:2dybA	0.046	0.193	1.130E-4	298	0.022	0.094	2dybA.pdb.gz
11	AFDB:E7F958	0.039	0.038	2.079E-4	1715	0.154	0.116	E7F958.pdb.gz	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1
12	PDB:3ehqA	0.044	0.300	2.103E-4	182	0.016	0.115	3ehqA.pdb.gz
13	PDB:6x5hA	0.045	0.125	2.225E-4	467	0.012	0.034	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
14	PDB:1k9aB	0.044	0.126	2.790E-4	441	0.015	0.043	1k9aB.pdb.gz
15	PDB:2h8hA	0.042	0.119	4.383E-4	445	0.012	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:3qwyA	0.053	0.333	6.152E-4	170	0.018	0.135	3qwyA.pdb.gz
17	PDB:4mt6A	0.040	0.132	1.212E-3	389	0.010	0.033	4mt6A.pdb.gz
18	AFDB:E7F981	0.031	0.024	2.642E-3	1814	0.101	0.072	E7F981.pdb.gz	E7F981_DANRE Nuclear pore complex protein Nup98-Nup96 OS=Danio rerio OX=7955 GN=im:7151238 PE=1 SV=3
19	AFDB:Q04164	0.038	0.034	3.129E-3	1693	0.135	0.103	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
20	AFDB:Q5JTC6	0.038	0.042	8.176E-3	1135	0.144	0.164	Q5JTC6.pdb.gz	AMER1_HUMAN APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q62417	0.0	590	1290	0.245	0.245	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
2	Q9BX66	0.0	2627	1292	1.000	1.000	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
3	S4R303	4.73e-64	225	393	0.090	0.295	S4R303_HUMAN Sorbin and SH3 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=2
4	O60504	7.66e-53	200	671	0.077	0.148	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
5	Q9R1Z8	2.59e-52	199	733	0.071	0.126	VINEX_MOUSE Vinexin OS=Mus musculus OX=10090 GN=Sorbs3 PE=1 SV=1
6	Q3UTJ2	1.37e-50	198	1180	0.079	0.086	SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sorbs2 PE=1 SV=2
7	O35413	4.39e-50	196	1196	0.077	0.083	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
8	O94875	3.47e-49	193	1100	0.073	0.085	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
9	Q966U9	1.18e-39	161	824	0.128	0.200	Q966U9_DROME DCAPL3 OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
10	Q7JR75	1.40e-39	161	824	0.128	0.200	Q7JR75_DROME CAP, isoform C OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
11	A1Z869	1.55e-39	161	811	0.128	0.203	A1Z869_DROME CAP, isoform F OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
12	A1Z870	2.15e-39	157	565	0.097	0.221	A1Z870_DROME CAP, isoform J OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
13	Q86P80	2.30e-39	158	630	0.130	0.267	Q86P80_DROME CAP, isoform K OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
14	Q7K1M7	2.60e-39	156	500	0.097	0.250	Q7K1M7_DROME CAP, isoform G OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
15	D3DMM3	2.77e-39	157	554	0.098	0.227	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
16	A0A0B4K7W2	4.02e-39	158	674	0.130	0.249	A0A0B4K7W2_DROME CAP, isoform U OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
17	A1Z866	5.07e-39	157	639	0.097	0.196	A1Z866_DROME CAP, isoform I OS=Drosophila melanogaster OX=7227 GN=CAP PE=1 SV=1
18	Q8IGN4	5.95e-39	157	647	0.097	0.193	Q8IGN4_DROME RE58362p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
19	B7YZD8	7.21e-39	161	2412	0.096	0.051	B7YZD8_DROME CAP, isoform Q OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=2
20	A0A0B4K6W0	2.25e-38	159	2458	0.130	0.068	A0A0B4K6W0_DROME CAP, isoform V OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	2.1e-32	121.8	SH3 domain
2	PF07653 SH3_2	5.2e-26	101.5	Variant SH3 domain
3	PF14604 SH3_9	5.9e-33	123.9	Variant SH3 domain
4	PF02208 Sorb	2.4e-19	80.0	Sorbin homologous domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000211998	0.998	Vinculin
3	9606.ENSP00000375960	0.987	Afadin
4	9606.ENSP00000440273	0.974	SH2B adapter protein 2
5	9606.ENSP00000365569	0.970	Flotillin-1
6	9606.ENSP00000303830	0.964	Insulin receptor
7	9606.ENSP00000361263	0.946	Rap guanine nucleotide exchange factor 1
8	9606.ENSP00000238738	0.935	Rho-related GTP-binding protein RhoQ
9	9606.ENSP00000267257	0.935	Paxillin
10	9606.ENSP00000380432	0.934	Insulin
11	9606.ENSP00000300574	0.930	Adapter molecule crk
12	9606.ENSP00000361423	0.919	Tyrosine-protein kinase ABL1
13	9606.ENSP00000304895	0.917	Insulin receptor substrate 1
14	9606.ENSP00000365402	0.902	HLA class I histocompatibility antigen, Cw-7 alpha chain
15	9606.ENSP00000240123	0.898	Vinexin
16	9606.ENSP00000282588	0.876	Integrin alpha-1
17	9606.ENSP00000256649	0.873	Tripartite motif-containing protein 45
18	9606.ENSP00000414147	0.865	Spartin
19	9606.ENSP00000439585	0.859	Ataxin-7
20	9606.ENSP00000316029	0.855	Talin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.893	cytoskeletal protein binding
GO:0060090	0.869	molecular adaptor activity
GO:0044877	0.843	protein-containing complex binding
GO:0035591	0.835	signaling adaptor activity
GO:0005102	0.815	signaling receptor binding
GO:0003779	0.795	actin binding
GO:0030159	0.723	signaling receptor complex adaptor activity
GO:0005158	0.719	insulin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007155	0.930	cell adhesion
GO:0050794	0.860	regulation of cellular process
GO:0007160	0.831	cell-matrix adhesion
GO:0050896	0.489	response to stimulus
GO:0048518	0.412	positive regulation of biological process
GO:0032501	0.376	multicellular organismal process
GO:0032502	0.354	developmental process
GO:0048522	0.341	positive regulation of cellular process
GO:0071840	0.330	cellular component organization or biogenesis
GO:0016043	0.313	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0070161	0.995	anchoring junction
GO:0005856	0.995	cytoskeleton
GO:0005634	0.989	nucleus
GO:0030055	0.953	cell-substrate junction
GO:0005925	0.937	focal adhesion
GO:0005911	0.879	cell-cell junction
GO:0015630	0.867	microtubule cytoskeleton
GO:0005815	0.863	microtubule organizing center
GO:0005813	0.792	centrosome
GO:0005912	0.785	adherens junction
GO:0005915	0.556	zonula adherens

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]