StarFunc result for job id Q9BX68

User Input

>input (163 residues)
MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRIL
DKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQ
TAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BX68	1.000	1.000	1.747E-30	163	1.000	1.000	Q9BX68.pdb.gz	HINT2_HUMAN Adenosine 5'-monophosphoramidase HINT2 OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1
2	AFDB:Q9D0S9	0.782	0.782	4.162E-27	163	0.859	0.859	Q9D0S9.pdb.gz	HINT2_MOUSE Adenosine 5'-monophosphoramidase HINT2 OS=Mus musculus OX=10090 GN=Hint2 PE=1 SV=1
3	PDB:6ypxAAA	0.690	0.994	1.078E-20	113	0.693	1.000	6ypxAAA.pdb.gz
4	AFDB:Q9I882	0.750	0.968	1.224E-18	126	0.466	0.603	Q9I882.pdb.gz	Q9I882_CHICK Protein kinase C inhibitor OS=Gallus gallus OX=9031 GN=chPKCI PE=2 SV=1
5	AFDB:A0A384NPU2	0.753	0.972	5.940E-18	126	0.460	0.595	A0A384NPU2.pdb.gz	A0A384NPU2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HINT1 PE=2 SV=1
6	AFDB:Q8GUN2	0.754	0.835	4.150E-17	147	0.399	0.442	Q8GUN2.pdb.gz	HINT1_ARATH Adenylylsulfatase HINT1 OS=Arabidopsis thaliana OX=3702 GN=HINT1 PE=1 SV=1
7	AFDB:Q8GYJ9	0.751	0.656	4.410E-17	187	0.448	0.390	Q8GYJ9.pdb.gz	Q8GYJ9_ARATH HISTIDINE TRIAD NUCLEOTIDE-BINDING 2 OS=Arabidopsis thaliana OX=3702 GN=HINT PE=1 SV=1
8	PDB:6g9zA	0.694	0.931	8.704E-16	121	0.429	0.579	6g9zA.pdb.gz
9	AFDB:P0ACE7	0.676	0.920	3.539E-13	119	0.313	0.429	P0ACE7.pdb.gz	HINT_ECOLI Purine nucleoside phosphoramidase OS=Escherichia coli (strain K12) OX=83333 GN=hinT PE=1 SV=1
10	PDB:3n1sJ	0.672	0.912	4.021E-13	119	0.313	0.429	3n1sJ.pdb.gz	Probing the Impact of the echinT C-Terminal Domain on Structure and Catalysis.
11	AFDB:Q23921	0.648	0.823	7.842E-12	127	0.325	0.417	Q23921.pdb.gz	PKIA_DICDI Protein pkiA OS=Dictyostelium discoideum OX=44689 GN=pkiA PE=1 SV=2
12	AFDB:Q04344	0.585	0.603	7.509E-9	158	0.239	0.247	Q04344.pdb.gz	HNT1_YEAST Adenosine 5'-monophosphoramidase HNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HNT1 PE=1 SV=2
13	AFDB:O94586	0.590	0.715	8.479E-9	133	0.202	0.248	O94586.pdb.gz	HNT1_SCHPO Adenosine 5'-monophosphoramidase hnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hnt1 PE=3 SV=1
14	PDB:3anoB	0.502	0.471	1.041E-5	175	0.117	0.109	3anoB.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
15	PDB:1emsA	0.483	0.202	1.107E-5	412	0.178	0.070	1emsA.pdb.gz
16	PDB:2fitA	0.479	0.591	1.250E-5	130	0.123	0.154	2fitA.pdb.gz	MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family.
17	PDB:3anoA	0.472	0.486	1.411E-5	158	0.117	0.120	3anoA.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
18	PDB:7p8pB	0.467	0.511	6.063E-5	147	0.129	0.143	7p8pB.pdb.gz	Chemical Proteomics of the Tumor Suppressor Fhit Covalently Bound to the Cofactor Ap 3 A Elucidates Its Inhibitory Action on Translation.
19	PDB:3jb9c	0.401	0.241	3.551E-3	300	0.117	0.063	3jb9c.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:6id0U	0.400	0.213	5.112E-3	347	0.092	0.043	6id0U.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BX68	5.66e-115	324	163	1.000	1.000	HINT2_HUMAN Adenosine 5'-monophosphoramidase HINT2 OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1
2	Q9D0S9	4.88e-93	268	163	0.859	0.859	HINT2_MOUSE Adenosine 5'-monophosphoramidase HINT2 OS=Mus musculus OX=10090 GN=Hint2 PE=1 SV=1
3	Q9I882	5.26e-55	171	126	0.466	0.603	Q9I882_CHICK Protein kinase C inhibitor OS=Gallus gallus OX=9031 GN=chPKCI PE=2 SV=1
4	F1RKI3	2.72e-54	169	126	0.472	0.611	F1RKI3_PIG Histidine triad nucleotide binding protein 1 OS=Sus scrofa OX=9823 GN=HINT1 PE=1 SV=1
5	A0A384NPU2	5.04e-53	166	126	0.460	0.595	A0A384NPU2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HINT1 PE=2 SV=1
6	P49773	5.04e-53	166	126	0.460	0.595	HINT1_HUMAN Adenosine 5'-monophosphoramidase HINT1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2
7	P70349	6.31e-52	163	126	0.454	0.587	HINT1_MOUSE Adenosine 5'-monophosphoramidase HINT1 OS=Mus musculus OX=10090 GN=Hint1 PE=1 SV=3
8	D4A269	2.89e-51	162	126	0.448	0.579	D4A269_RAT Histidine triad nucleotide binding protein 1, pseudogene 1 OS=Rattus norvegicus OX=10116 GN=Hint1 PE=1 SV=1
9	Q8GUN2	3.29e-42	139	147	0.399	0.442	HINT1_ARATH Adenylylsulfatase HINT1 OS=Arabidopsis thaliana OX=3702 GN=HINT1 PE=1 SV=1
10	Q8GYJ9	8.96e-41	137	187	0.387	0.337	Q8GYJ9_ARATH HISTIDINE TRIAD NUCLEOTIDE-BINDING 2 OS=Arabidopsis thaliana OX=3702 GN=HINT PE=1 SV=1
11	Q23921	1.30e-30	109	127	0.319	0.409	PKIA_DICDI Protein pkiA OS=Dictyostelium discoideum OX=44689 GN=pkiA PE=1 SV=2
12	P0ACE7	1.88e-27	101	119	0.313	0.429	HINT_ECOLI Purine nucleoside phosphoramidase OS=Escherichia coli (strain K12) OX=83333 GN=hinT PE=1 SV=1
13	F4K1R2	1.86e-10	58.9	197	0.196	0.162	HINT3_ARATH Adenylylsulfatase HINT3 OS=Arabidopsis thaliana OX=3702 GN=HINT3 PE=1 SV=1
14	Q84VV6	3.90e-10	57.0	146	0.196	0.219	HINT4_ARATH Bifunctional adenosine 5'-phosphosulfate phosphorylase/adenylylsulfatase HINT4 OS=Arabidopsis thaliana OX=3702 GN=HINT4 PE=1 SV=1
15	Q9I871	3.99e-10	56.6	130	0.245	0.308	Q9I871_CHICK Histidine triad missing OS=Gallus gallus OX=9031 GN=Wpkci-7 PE=2 SV=1
16	Q04344	6.68e-10	56.6	158	0.227	0.234	HNT1_YEAST Adenosine 5'-monophosphoramidase HNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HNT1 PE=1 SV=2
17	Q9I870	4.02e-09	53.9	130	0.239	0.300	Q9I870_CHICK ASW OS=Gallus gallus OX=9031 GN=Wpkci-8 PE=2 SV=1
18	O94586	1.50e-08	52.8	133	0.190	0.233	HNT1_SCHPO Adenosine 5'-monophosphoramidase hnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hnt1 PE=3 SV=1
19	Q9NQE9	4.84e-07	49.3	182	0.172	0.154	HINT3_HUMAN Adenosine 5'-monophosphoramidase HINT3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1
20	O76463	4.04e-06	47.8	440	0.209	0.077	NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans OX=6239 GN=nft-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11969 DcpS_C	7.3e-17	73.3	Scavenger mRNA decapping enzyme C-term binding
2	PF01230 HIT	2.4e-23	94.0	HIT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229633	0.713	Histidine triad nucleotide-binding protein 3
2	9606.ENSP00000287490	0.651	Cytochrome c oxidase subunit 6A2, mitochondrial
3	9606.ENSP00000467262	0.642	Cytochrome b-c1 complex subunit 10
4	9606.ENSP00000400806	0.567	Aprataxin
5	9606.ENSP00000479969	0.561	Angiopoietin-like protein 8
6	9606.ENSP00000281031	0.559	NADH dehydrogenase [ubiquinone] 1 subunit C2
7	9606.ENSP00000268668	0.537	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
8	9606.ENSP00000447942	0.522	Prefoldin subunit 5
9	9606.ENSP00000340982	0.518	Sperm-associated antigen 8
10	9606.ENSP00000367615	0.510	Adenine phosphoribosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016811	0.999	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0005488	0.974	binding
GO:0043530	0.962	adenosine 5'-monophosphoramidase activity
GO:0005515	0.946	protein binding
GO:0016817	0.340	hydrolase activity, acting on acid anhydrides

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0080090	0.909	regulation of primary metabolic process
GO:0051171	0.908	regulation of nitrogen compound metabolic process
GO:0009987	0.862	cellular process
GO:0009056	0.824	catabolic process
GO:0044237	0.697	cellular metabolic process
GO:1901575	0.685	organic substance catabolic process
GO:0051246	0.666	regulation of protein metabolic process
GO:0006807	0.563	nitrogen compound metabolic process
GO:0050794	0.459	regulation of cellular process
GO:0031399	0.454	regulation of protein modification process
GO:0048519	0.436	negative regulation of biological process
GO:1901360	0.435	organic cyclic compound metabolic process
GO:1901983	0.429	regulation of protein acetylation
GO:0006725	0.424	cellular aromatic compound metabolic process
GO:0034641	0.419	cellular nitrogen compound metabolic process
GO:0006139	0.408	nucleobase-containing compound metabolic process
GO:1901564	0.357	organonitrogen compound metabolic process
GO:0043170	0.320	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.969	membrane
GO:0031966	0.912	mitochondrial membrane
GO:0019867	0.622	outer membrane
GO:0005741	0.612	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	0.999	In linear amides.
RHEA:67916	0.962	adenosine 5'-phosphoramidate + H2O = AMP + NH4(+)
EC:3.6.-.-	0.340	Acting on acid anhydrides.

[back to server]