StarFunc result for job id Q9BX69

User Input

>input (1037 residues)
MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKL
LILVQKKGEATCQHFLKCLFSTFPQSAAICGLRHEVLKHENTVPPQSMGASSNSEDAFSP
GIKQPEAPEITVFFSEKEHLDLETSEFFRDKKTSYRETALSARKNEKEYDTPEVTLSYSV
EKVGCEVPATITYIKDGQRYEELDDSLYLGKEEYLGSVDTPEDAEATVEEEVYDDPEHVG
YDGEEDFENSETTEFSGEEPSYEGSETSLSLEEEQEKSIEERKKVFKDVLLCLNMDRSRK
VLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVLDEDSKEDLLA
GVENLEIRDIQTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM
LGAMKDIVKKQSTQFSGGPTEDTEKFLTLMKMPVISFVRLGYCSFSKSRILNTLLSPAQL
KLHKIFLHQDLPLLVLPRQISDGLVEITWCFPDSDDRKENPFFQKPVALANLRGNLESFW
TQFGFLMEVSSAVFFFTDCLGEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRIL
NLKPAQLLFWERGDAGDRRKNMEGLQAALQEVMFSSCLRCVSVEDMAALARELGIQVDED
FENTQRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALMPIQEPGTQCELSQNLQNLYG
TPVFRPVLENSWLFPTRIGGNFNHVSLKASWVMGRPFGSEQRPKWFHPLPFQNAGAQGRG
KSFGIQSFHPQIFYSGERFMKFSRVARGCHSNGTFGRLPRPICQHVQACPERPQMMGTLE
RSRAVASKIGHSYSLDSQPARAVGKPWPQQACTRVTELTEATGKLIRTSHIGKPHPQSFQ
PAAATQKLRPASQQGVQMKTQGGASNPALQIGSHPMCKSSQFKSDQSNPSTVKHSQPKPF
HSVPSQPKSSQTKSCQSQPSQTKPSPCKSTQPKPSQPWPPQSKPSQPRPPQPKSSSTNPS
QAKAHHSKAGQKRGGKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BX69	1.000	1.000	0.000	1037	1.000	1.000	Q9BX69.pdb.gz	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
2	PDB:3zjcE	0.127	0.370	1.893E-4	286	0.031	0.112	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
3	PDB:3zjcF	0.141	0.454	5.430E-4	252	0.024	0.099	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
4	AFDB:A0A0B4KF25	0.076	0.072	5.640E-4	1131	0.114	0.104	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
5	PDB:6k1zA	0.150	0.264	1.402E-3	544	0.035	0.066	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
6	PDB:6z3eA	0.124	0.432	1.402E-3	237	0.023	0.101	6z3eA.pdb.gz	Crystal structure of GDP-bound human GIMAP5
7	PDB:7pw4C	0.133	0.376	3.091E-3	310	0.027	0.090	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
8	PDB:7nfxv	0.109	0.406	3.258E-3	186	0.030	0.167	7nfxv.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
9	PDB:6lojB	0.140	0.227	4.023E-3	571	0.032	0.058	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
10	AFDB:Q21216	0.053	0.044	4.178E-3	1338	0.136	0.105	Q21216.pdb.gz	Q21216_CAEEL GON-4-like protein OS=Caenorhabditis elegans OX=6239 GN=gon-4 PE=1 SV=2
11	PDB:1uptG	0.106	0.435	5.236E-3	170	0.025	0.153	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
12	PDB:6yxyEQ	0.125	0.247	6.132E-3	471	0.027	0.059	6yxyEQ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:3a58F	0.106	0.424	8.868E-3	181	0.029	0.166	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
14	AFDB:O96221	0.062	0.050	1.644E-2	1471	0.103	0.073	O96221.pdb.gz	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3
15	AFDB:Q6P0N0	0.051	0.048	3.262E-2	1132	0.106	0.097	Q6P0N0.pdb.gz	M18BP_HUMAN Mis18-binding protein 1 OS=Homo sapiens OX=9606 GN=MIS18BP1 PE=1 SV=1
16	AFDB:Q7TNC6	0.063	0.040	3.262E-2	2112	0.116	0.057	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
17	AFDB:P49750	0.049	0.028	4.476E-2	2146	0.123	0.060	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
18	AFDB:F1R5H6	0.067	0.054	5.526E-2	1444	0.148	0.106	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
19	AFDB:O77086	0.049	0.038	7.581E-2	1571	0.114	0.075	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
20	AFDB:F8VXC8	0.049	0.044	9.360E-2	1245	0.133	0.111	F8VXC8.pdb.gz	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BX69	0.0	2150	1037	1.000	1.000	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
2	Q8TCY9	2.17e-53	204	931	0.140	0.156	URGCP_HUMAN Up-regulator of cell proliferation OS=Homo sapiens OX=9606 GN=URGCP PE=1 SV=2
3	Q9D1X0	2.33e-11	67.0	220	0.047	0.223	NOL3_MOUSE Nucleolar protein 3 OS=Mus musculus OX=10090 GN=Nol3 PE=1 SV=1
4	O60936	2.67e-11	66.2	208	0.046	0.231	NOL3_HUMAN Nucleolar protein 3 OS=Homo sapiens OX=9606 GN=NOL3 PE=1 SV=2
5	Q62881	3.03e-11	66.6	221	0.047	0.222	NOL3_RAT Nucleolar protein 3 OS=Rattus norvegicus OX=10116 GN=Nol3 PE=1 SV=1
6	Q9JKS6	2.87e-04	47.8	5085	0.036	0.007	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
7	Q9QYX7	0.002	45.1	5068	0.039	0.008	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
8	P57730	0.010	38.5	90	0.022	0.256	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
9	A0A060X8V7	0.80	36.2	951	0.016	0.018	A0A060X8V7_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047677001 PE=4 SV=1
10	A0A0K0KIB0	0.85	36.2	954	0.016	0.018	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
11	Q4V958	2.1	34.7	584	0.018	0.033	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
12	F8W3K2	2.2	34.7	980	0.026	0.028	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
13	Q14155	2.7	34.3	803	0.020	0.026	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
14	Q9ES28	2.7	34.3	862	0.021	0.026	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
15	Q9Y6V0	3.1	34.3	5142	0.042	0.009	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
16	Q5XIW4	3.5	33.9	602	0.029	0.050	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
17	Q62170	3.5	33.9	397	0.024	0.063	SELPL_MOUSE P-selectin glycoprotein ligand 1 OS=Mus musculus OX=10090 GN=Selplg PE=1 SV=2
18	A0A0G2JTI9	3.8	33.9	638	0.029	0.047	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
19	A0A384MTQ8	4.1	33.9	548	0.025	0.047	A0A384MTQ8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
20	P32780	4.1	33.9	548	0.025	0.047	TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens OX=9606 GN=GTF2H1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.1e-09	49.5	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220751	0.971	Receptor-interacting serine/threonine-protein kinase 2
2	9606.ENSP00000222823	0.727	Nucleotide-binding oligomerization domain-containing protein 1
3	9606.ENSP00000259808	0.705	Receptor-interacting serine/threonine-protein kinase 1
4	9606.ENSP00000375767	0.700	Caspase recruitment domain-containing protein 8
5	9606.ENSP00000478516	0.548	NACHT, LRR and PYD domains-containing protein 1
6	9606.ENSP00000338533	0.515	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.326	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.973	response to stimulus
GO:0019222	0.939	regulation of metabolic process
GO:0060255	0.883	regulation of macromolecule metabolic process
GO:0048518	0.838	positive regulation of biological process
GO:0048583	0.808	regulation of response to stimulus
GO:0010468	0.672	regulation of gene expression
GO:0051716	0.671	cellular response to stimulus
GO:0051171	0.644	regulation of nitrogen compound metabolic process
GO:0080090	0.639	regulation of primary metabolic process
GO:0010646	0.562	regulation of cell communication
GO:0023051	0.561	regulation of signaling
GO:0031323	0.528	regulation of cellular metabolic process
GO:0048522	0.516	positive regulation of cellular process
GO:0007154	0.497	cell communication
GO:0009966	0.487	regulation of signal transduction
GO:0051246	0.482	regulation of protein metabolic process
GO:0010941	0.458	regulation of cell death
GO:0065009	0.427	regulation of molecular function
GO:0006950	0.394	response to stress
GO:0023052	0.381	signaling
GO:1902531	0.371	regulation of intracellular signal transduction
GO:0080134	0.358	regulation of response to stress
GO:0031326	0.354	regulation of cellular biosynthetic process
GO:0009605	0.341	response to external stimulus
GO:0008219	0.336	cell death
GO:0007165	0.336	signal transduction
GO:0048584	0.334	positive regulation of response to stimulus
GO:0044419	0.326	biological process involved in interspecies interaction between organisms
GO:0051239	0.320	regulation of multicellular organismal process
GO:0012501	0.320	programmed cell death
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0048519	0.317	negative regulation of biological process
GO:0048523	0.306	negative regulation of cellular process
GO:0043122	0.304	regulation of I-kappaB kinase/NF-kappaB signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.966	organelle
GO:0032991	0.964	protein-containing complex
GO:0043227	0.939	membrane-bounded organelle
GO:0043229	0.926	intracellular organelle
GO:0043231	0.818	intracellular membrane-bounded organelle
GO:0005634	0.676	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]