StarFunc result for job id Q9BX84

User Input

>input (2022 residues)
MKEQPVLERLQSQKSWIKGVFDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGD
HAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKL
DHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGIN
TGVSKHVGDALKSHSSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTT
LNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVI
LSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLK
QSKHLFQILMECMVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDR
VDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYN
TKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNN
LYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPE
STGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDD
ASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFV
SHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTILTLEFKSKAEMSHVPQSQDFQFM
WYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIV
KFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ
KVKVWISEYWNLTETVAIGLFSAGFVLRWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVN
QHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWM
IYGEVYAGEIDVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESIS
NNLWKYNRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEEGDVGLKLYLSK
EDLKKLHDFEEQCVEKYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIKDS
LLSLDSQVGHLQDLSALTVDTLKVLSAVDTLQEDEALLAKRKHSTCKKLPHSWSNVICAE
VLGSMEIAGEKKYQYYSMPSSLLRSLAGGRHPPRVQRGALLEITNSKREATNVRNDQERQ
ETQSSIVVSGVSPNRQAHSKYGQFLLVPSNLKRVPFSAETVLPLSRPSVPDVLATEQDIQ
TEVLVHLTGQTPVVSDWASVDEPKEKHEPIAHLLDGQDKAEQVLPTLSCTPEPMTMSSPL
SQAKIMQTGGGYVNWAFSEGDETGVFSIKKKWQTCLPSTCDSDSSRSEQHQKQAQDSSLS
DNSTRSAQSSECSEVGPWLQPNTSFWINPLRRYRPFARSHSFRFHKEEKLMKICKIKNLS
GSSEIGQGAWVKAKMLTKDRRLSKKKKNTQGLQVPIITVNACSQSDQLNPEPGENSISEE
EYSKNWFTVSKFSHTGVEPYIHQKMKTKEIGQCAIQISDYLKQSQEDLSKNSLWNSRSTN
LNRNSLLKSSIGVDKISASLKSPQEPHHHYSAIERNNLMRLSQTIPFTPVQLFAGEEITV
YRLEESSPLNLDKSMSSWSQRGRAAMIQVLSREEMDGGLRKAMRVVSTWSEDDILKPGQV
FIVKSFLPEVVRTWHKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRFLE
VFLIYCHSANQWLTIEKYMTGEFRKYNNNNGDEITPTNTLEELMLAFSHWTYEYTRGELL
VLDLQGVGENLTDPSVIKPEVKQSRGMVFGPANLGEDAIRNFIAKHHCNSCCRKLKLPDL
KRNDYSPERINSTFGLEIKIESAEEPPARETGRNSPEDDMQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CIR4	0.767	0.765	0.000	2028	0.779	0.777	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
2	AFDB:Q9BX84	1.000	1.000	0.000	2022	1.000	1.000	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
3	AFDB:Q9HCF6	0.546	0.636	0.000	1732	0.368	0.430	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
4	AFDB:Q20766	0.492	0.692	8.383E-86	1406	0.203	0.292	Q20766.pdb.gz	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
5	PDB:6co7A	0.450	0.838	4.398E-69	1061	0.176	0.335	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
6	PDB:6puuA	0.453	0.682	6.224E-61	1309	0.161	0.249	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
7	PDB:6bcqB	0.405	0.779	4.143E-53	983	0.147	0.302	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
8	PDB:6drjA	0.384	0.576	8.426E-53	1266	0.157	0.251	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
9	PDB:6bqrA	0.398	0.798	1.268E-50	948	0.147	0.313	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
10	PDB:6mj2A	0.411	0.590	1.455E-49	1337	0.165	0.250	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
11	PDB:6pkxB	0.376	0.583	6.290E-49	1218	0.155	0.257	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
12	PDB:6pkvA	0.389	0.702	7.252E-47	1087	0.142	0.265	6pkvA.pdb.gz
13	PDB:5wp6A	0.390	0.752	1.925E-46	977	0.149	0.309	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
14	PDB:8e4nA	0.362	0.748	5.608E-45	901	0.123	0.275	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
15	AFDB:Q86TB3	0.111	0.104	1.077E-11	2170	0.082	0.076	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
16	AFDB:Q14152	0.053	0.069	9.311E-5	1382	0.088	0.128	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
17	AFDB:Q5SUF7	0.094	0.082	1.733E-4	2381	0.067	0.057	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	AFDB:P27732	0.098	0.092	2.471E-4	2203	0.088	0.081	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
19	AFDB:Q13936	0.109	0.101	4.599E-4	2221	0.097	0.088	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
20	AFDB:Q99246	0.098	0.093	5.254E-4	2179	0.084	0.078	Q99246.pdb.gz	CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus OX=10090 GN=Cacna1d PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7T1N0	0.0	626	1551	0.199	0.260	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
2	A8DYE2	0.0	986	2023	0.255	0.255	TRPCG_DROME Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1
3	Q20766	0.0	706	1406	0.206	0.296	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
4	Q2TV84	0.0	1276	1622	0.326	0.407	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
5	Q563W7	0.0	1485	1774	0.368	0.419	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
6	Q7Z4N2	0.0	833	1603	0.210	0.265	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
7	Q8CIR4	0.0	3190	2028	0.783	0.781	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
8	Q923J1	0.0	1544	1863	0.376	0.408	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
9	Q925B3	0.0	1539	1862	0.374	0.407	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
10	Q96QT4	0.0	1545	1865	0.376	0.408	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
11	Q9BX84	0.0	4228	2022	1.000	1.000	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
12	Q9HCF6	0.0	1381	1732	0.342	0.399	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
13	G5ECM4	1.99e-151	514	1694	0.143	0.171	G5ECM4_CAEEL GTL-1 OS=Caenorhabditis elegans OX=6239 GN=gtl-1 PE=1 SV=1
14	A0A0R4IMY7	6.68e-132	454	1470	0.184	0.253	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
15	Q9JJH7	1.33e-123	423	1158	0.170	0.297	TRPM5_MOUSE Transient receptor potential cation channel subfamily M member 5 OS=Mus musculus OX=10090 GN=Trpm5 PE=1 SV=1
16	Q9NZQ8	2.92e-123	422	1165	0.167	0.289	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
17	A0A455XI77	9.27e-123	420	1156	0.165	0.289	A0A455XI77_RAT Transient receptor potential cation channel subfamily M member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=2 SV=1
18	Q7TN37	9.75e-123	421	1213	0.166	0.277	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
19	A0A8I6AG64	1.08e-122	420	1164	0.165	0.287	A0A8I6AG64_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=1
20	F1LMD7	1.56e-122	420	1187	0.165	0.281	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02816 Alpha_kinase	4.7e-41	152.5	Alpha-kinase family
2	PF00520 Ion_trans	7.1e-07	40.3	Ion transport protein
3	PF18139 LSDAT_euk	3.4e-113	389.0	SLOG in TRPM
4	PF18171 LSDAT_prok	6.7e-16	69.6	SLOG in TRPM, prokaryote
5	PF16519 TRPM_tetra	4.8e-20	82.7	Tetramerisation domain of TRPM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441875	0.922	Prohibitin-2
2	9606.ENSP00000320239	0.858	Transient receptor potential cation channel subfamily M member 7
3	9606.ENSP00000265310	0.810	Transient receptor potential cation channel subfamily V member 5
4	9606.ENSP00000356105	0.801	Solute carrier family 41 member 1
5	9606.ENSP00000402152	0.761	Solute carrier family 12 member 3
6	9606.ENSP00000419313	0.759	Short transient receptor potential channel 1
7	9606.ENSP00000352358	0.757	Transient receptor potential cation channel subfamily V member 6
8	9606.ENSP00000264734	0.754	Claudin-16
9	9606.ENSP00000406191	0.750	Transient receptor potential cation channel subfamily V member 4
10	9606.ENSP00000258538	0.737	Solute carrier family 41 member 2
11	9606.ENSP00000354649	0.735	Magnesium transporter protein 1
12	9606.ENSP00000358894	0.734	Metal transporter CNNM2
13	9606.ENSP00000459962	0.720	Transient receptor potential cation channel, subfamily V, member 1
14	9606.ENSP00000461007	0.720	Transient receptor potential cation channel subfamily V member 1
15	9606.ENSP00000326070	0.691	Solute carrier family 41 member 3
16	9606.ENSP00000301365	0.689	Transient receptor potential cation channel subfamily V member 3
17	9606.ENSP00000262209	0.683	Transient receptor potential cation channel subfamily A member 1
18	9606.ENSP00000426909	0.672	Receptor of activated protein C kinase 1
19	9606.ENSP00000399585	0.666	Magnesium transporter MRS2 homolog, mitochondrial
20	9606.ENSP00000342222	0.664	Transient receptor potential cation channel subfamily V member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	1.000	calcium channel activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.996	transport
GO:0030001	0.993	metal ion transport
GO:0009987	0.975	cellular process
GO:0071702	0.861	organic substance transport
GO:0006816	0.832	calcium ion transport
GO:0055085	0.751	transmembrane transport
GO:0034220	0.675	monoatomic ion transmembrane transport
GO:0098660	0.648	inorganic ion transmembrane transport
GO:0098655	0.646	monoatomic cation transmembrane transport
GO:0098662	0.625	inorganic cation transmembrane transport
GO:0070588	0.559	calcium ion transmembrane transport
GO:0050896	0.531	response to stimulus
GO:0065007	0.394	biological regulation
GO:0050789	0.353	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]