StarFunc result for job id Q9BXD5

User Input

>input (320 residues)
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSV
SERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWT
KDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLL
DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFS
LALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKL
KSLDFLSFTDLKDGNLEAGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXD5	1.000	1.000	3.227E-58	320	1.000	1.000	Q9BXD5.pdb.gz	NPL_HUMAN N-acetylneuraminate lyase OS=Homo sapiens OX=9606 GN=NPL PE=1 SV=1
2	PDB:6arhB	0.941	0.994	3.341E-51	303	0.947	1.000	6arhB.pdb.gz
3	AFDB:Q9DCJ9	0.961	0.961	5.284E-51	320	0.856	0.856	Q9DCJ9.pdb.gz	NPL_MOUSE N-acetylneuraminate lyase OS=Mus musculus OX=10090 GN=Npl PE=1 SV=1
4	AFDB:Q6NYR8	0.934	0.973	3.690E-40	307	0.516	0.537	Q6NYR8.pdb.gz	NPL_DANRE N-acetylneuraminate lyase OS=Danio rerio OX=7955 GN=npl PE=2 SV=1
5	AFDB:P0A6L4	0.823	0.884	2.995E-23	297	0.259	0.279	P0A6L4.pdb.gz	NANA_ECOLI N-acetylneuraminate lyase OS=Escherichia coli (strain K12) OX=83333 GN=nanA PE=1 SV=2
6	PDB:2wpbA	0.838	0.886	6.394E-23	302	0.256	0.272	2wpbA.pdb.gz	Structural Insights Into Substrate Specificity in Variants of N-Acetylneuraminic Acid Lyase Produced by Directed Evolution.
7	AFDB:P39359	0.867	0.919	1.583E-21	301	0.244	0.259	P39359.pdb.gz	YJHH_ECOLI Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH OS=Escherichia coli (strain K12) OX=83333 GN=yjhH PE=1 SV=2
8	AFDB:P75682	0.868	0.918	9.565E-21	302	0.244	0.258	P75682.pdb.gz	YAGE_ECOLI Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE OS=Escherichia coli (strain K12) OX=83333 GN=yagE PE=1 SV=2
9	PDB:3s5oA	0.833	0.897	3.287E-20	296	0.247	0.267	3s5oA.pdb.gz
10	AFDB:Q9DCU9	0.844	0.842	6.773E-20	321	0.241	0.240	Q9DCU9.pdb.gz	HOGA1_MOUSE 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus OX=10090 GN=Hoga1 PE=1 SV=1
11	PDB:3nevA	0.859	0.920	2.327E-19	298	0.234	0.252	3nevA.pdb.gz	Identification of biochemical and putative biological role of a xenolog from Escherichia coli using structural analysis.
12	PDB:5j5dA	0.831	0.892	2.587E-19	297	0.256	0.276	5j5dA.pdb.gz	Inhibition of Mycobacterium tuberculosis dihydrodipicolinate synthase by alpha-ketopimelic acid and its other structural analogues
13	AFDB:Q0P5I5	0.838	0.821	2.680E-19	327	0.241	0.235	Q0P5I5.pdb.gz	HOGA1_BOVIN 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Bos taurus OX=9913 GN=HOGA1 PE=1 SV=1
14	AFDB:P9WP25	0.843	0.897	3.311E-19	300	0.256	0.273	P9WP25.pdb.gz	DAPA_MYCTU 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dapA PE=1 SV=1
15	AFDB:Q704D1	0.812	0.848	1.060E-18	306	0.200	0.209	Q704D1.pdb.gz	KDGA_THETE 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase OS=Thermoproteus tenax OX=2271 GN=kdgA PE=1 SV=1
16	PDB:5c54A	0.836	0.861	2.036E-18	310	0.212	0.219	5c54A.pdb.gz
17	PDB:2r94A	0.818	0.911	3.278E-18	286	0.191	0.213	2r94A.pdb.gz	Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
18	PDB:5t26B	0.823	0.892	5.277E-18	294	0.216	0.235	5t26B.pdb.gz
19	PDB:2nuyA	0.807	0.892	8.057E-18	288	0.225	0.250	2nuyA.pdb.gz	Biochemical and structural exploration of the catalytic capacity of Sulfolobus KDG aldolases
20	PDB:6g3zA	0.802	0.872	4.868E-17	293	0.212	0.232	6g3zA.pdb.gz	Insights into the Substrate Specificity of Archaeal Entner-Doudoroff Aldolases: The Structures of Picrophilus torridus 2-Keto-3-deoxygluconate Aldolase and Sulfolobus solfataricus 2-Keto-3-deoxy-6-phosphogluconate Aldolase in Complex with 2-Keto-3-deoxy-6-phosphogluconate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BEC7	0.0	606	319	0.922	0.925	NPL_PIG N-acetylneuraminate lyase OS=Sus scrofa OX=9823 GN=NPL PE=1 SV=1
2	Q9BXD5	0.0	652	320	1.000	1.000	NPL_HUMAN N-acetylneuraminate lyase OS=Homo sapiens OX=9606 GN=NPL PE=1 SV=1
3	Q9DCJ9	0.0	566	320	0.853	0.853	NPL_MOUSE N-acetylneuraminate lyase OS=Mus musculus OX=10090 GN=Npl PE=1 SV=1
4	Q6NYR8	3.07e-109	322	307	0.491	0.511	NPL_DANRE N-acetylneuraminate lyase OS=Danio rerio OX=7955 GN=npl PE=2 SV=1
5	P0A6L4	2.33e-33	126	297	0.266	0.286	NANA_ECOLI N-acetylneuraminate lyase OS=Escherichia coli (strain K12) OX=83333 GN=nanA PE=1 SV=2
6	P9WP25	1.57e-25	105	300	0.263	0.280	DAPA_MYCTU 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dapA PE=1 SV=1
7	P75682	1.96e-21	94.4	302	0.216	0.228	YAGE_ECOLI Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE OS=Escherichia coli (strain K12) OX=83333 GN=yagE PE=1 SV=2
8	P39359	7.03e-20	90.1	301	0.266	0.282	YJHH_ECOLI Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH OS=Escherichia coli (strain K12) OX=83333 GN=yjhH PE=1 SV=2
9	Q86XE5	7.76e-19	87.4	327	0.263	0.257	HOGA1_HUMAN 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Homo sapiens OX=9606 GN=HOGA1 PE=1 SV=1
10	Q8UGL3	1.19e-18	86.7	294	0.222	0.241	DAPA_AGRFC 4-hydroxy-tetrahydrodipicolinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=dapA PE=1 SV=1
11	Q97U28	2.44e-18	85.9	308	0.219	0.227	KDGA_SACS2 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eda PE=1 SV=1
12	O54288	4.10e-18	85.1	294	0.219	0.238	KDGA_SACSO 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Saccharolobus solfataricus OX=2287 PE=1 SV=1
13	Q4JC35	4.33e-18	84.7	288	0.216	0.240	KDGA_SULAC 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=Saci_0225 PE=1 SV=1
14	Q97R25	6.76e-18	84.7	311	0.266	0.273	DAPA_STRPN 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=dapA PE=1 SV=1
15	Q0P5I5	7.29e-18	84.7	327	0.266	0.260	HOGA1_BOVIN 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Bos taurus OX=9913 GN=HOGA1 PE=1 SV=1
16	Q9DCU9	2.18e-17	83.6	321	0.263	0.262	HOGA1_MOUSE 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus OX=10090 GN=Hoga1 PE=1 SV=1
17	Q704D1	2.74e-16	80.1	306	0.228	0.239	KDGA_THETE 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase OS=Thermoproteus tenax OX=2271 GN=kdgA PE=1 SV=1
18	F9VPG1	6.94e-15	75.9	290	0.225	0.248	KDGA_SULTO 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=kdgA PE=1 SV=1
19	P0A6L2	1.11e-13	72.4	292	0.237	0.260	DAPA_ECOLI 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain K12) OX=83333 GN=dapA PE=1 SV=1
20	Q8NMD2	9.03e-12	67.0	312	0.175	0.179	Q8NMD2_CORGL Dihydrodipicolinate synthase/N-acetylneuraminate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl2646 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00701 DHDPS	3e-48	175.6	Dihydrodipicolinate synthetase family
2	PF05343 Peptidase_M42	43	14.6	M42 glutamyl aminopeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379839	0.967	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
2	9606.ENSP00000377303	0.959	N-acylglucosamine 2-epimerase
3	9606.ENSP00000210444	0.955	Sialic acid synthase
4	9606.ENSP00000345974	0.827	Mitochondrial enolase superfamily member 1
5	9606.ENSP00000229329	0.787	N-acylneuraminate cytidylyltransferase
6	9606.ENSP00000364782	0.734	Sialidase-1
7	9606.ENSP00000302441	0.726	N-acylneuraminate-9-phosphatase
8	9606.ENSP00000416126	0.717	Proline-rich acidic protein 1
9	9606.ENSP00000321343	0.714	Alpha-2,8-sialyltransferase 8E
10	9606.ENSP00000260116	0.677	Alpha-tocopherol transfer protein
11	9606.ENSP00000311677	0.610	Nuclear inhibitor of protein phosphatase 1
12	9606.ENSP00000378920	0.601	Solute carrier family 26 member 6
13	9606.ENSP00000330658	0.577	Pappalysin-1
14	9606.ENSP00000357838	0.569	Ornithine aminotransferase, mitochondrial
15	9606.ENSP00000436047	0.562	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
16	9606.ENSP00000317439	0.543	Canopy FGF signaling regulator 1
17	9606.ENSP00000268389	0.537	Immunoglobulin superfamily member 6
18	9606.ENSP00000379997	0.528	Protein GAPT
19	9606.ENSP00000430620	0.516	Hephaestin
20	9606.ENSP00000465930	0.513	Galactokinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016833	1.000	oxo-acid-lyase activity
GO:0005488	0.997	binding
GO:0005515	0.993	protein binding
GO:0042802	0.858	identical protein binding
GO:0008747	0.789	N-acetylneuraminate lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043603	0.997	amide metabolic process
GO:1901565	0.997	organonitrogen compound catabolic process
GO:0044237	0.996	cellular metabolic process
GO:0046348	0.996	amino sugar catabolic process
GO:0046395	0.992	carboxylic acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.930	membrane-bounded organelle
GO:0043231	0.917	intracellular membrane-bounded organelle
GO:0005634	0.322	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.3.-	1.000	Oxo-acid-lyases.
RHEA:23296	0.789	aceneuramate = N-acetyl-D-mannosamine + pyruvate
EC:4.1.3.3	0.789	N-acetylneuraminate lyase.

[back to server]