StarFunc result for job id Q9BXF3

User Input

>input (1484 residues)
MCPEEGGAAGLGELRSWWEVPAIAHFCSLFRTAFRLPDFEIEELEAALHRDDVEFISDLI
ACLLQGCYQRRDITPQTFHSYLEDIINYRWELEEGKPNPLREASFQDLPLRTRVEILHRL
CDYRLDADDVFDLLKGLDADSLRVEPLGEDNSGALYWYFYGTRMYKEDPVQGKSNGELSL
SRESEGQKNVSSIPGKTGKRRGRPPKRKKLQEEILLSEKQEENSLASEPQTRHGSQGPGQ
GTWWLLCQTEEEWRQVTESFRERTSLRERQLYKLLSEDFLPEICNMIAQKGKRPQRTKAE
LHPRWMSDHLSIKPVKQEETPVLTRIEKQKRKEEEEERQILLAVQKKEQEQMLKEERKRE
LEEKVKAVEGMCSVRVVWRGACLSTSRPVDRAKRRKLREERAWLLAQGKELPPELSHLDP
NSPMREEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMD
ISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFP
GEDGDTDEEFWIREDEKREKRRSRAGRSGGSHVWTRSRDPEGSSRKQQPMENGGKSLPPT
RRAPSSGDDQSSSSTQPPREVGTSNGRGFSHPLHCGGTPSQAPFLNQMRPAVPGTFGPLR
GSDPATLYGSSGVPEPHPGEPVQQRQPFTMQPPVGINSLRGPRLGTPEEKQMCGGLTHLS
NMGPHPGSLQLGQISGPSQDGSMYAPAQFQPGFIPPRHGGAPARPPDFPESSEIPPSHMY
RSYKYLNRVHSAVWNGNHGATNQGPLGPDEKPHLGPGPSHQPRTLGHVMDSRVMRPPVPP
NQWTEQSGFLPHGVPSSGYMRPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGVQGGDSMM
DSPEMIAMQQLSSRVCPPGVPYHPHQPAHPRLPGPFPQVAHPMSVTVSAPKPALGNPGRA
PENSEAQEPENDQAEPLPGLEEKPPGVGTSEGVYLTQLPHPTPPLQTDCTRQSSPQERET
VGPELKSSSSESADNCKAMKGKNPWPSDSSYPGPAAQGCVRDLSTVADRGALSENGVIGE
ASPCGSEGKGLGSSGSEKLLCPRGRTLQETMPCTGQNAATPPSTDPGLTGGTVSQFPPLY
MPGLEYPNSAAHYHISPGLQGVGPVMGGKSPASHPQHFPPRGFQSNHPHSGGFPRYRPPQ
GMRYSYHPPPQPSYHHYQRTPYYACPQSFSDWQRPLHPQGSPSGPPASQPPPPRSLFSDK
NAMASLQGCETLNAALTSPTRMDAVAAKVPNDGQNPGPEEEKLDESMERPESPKEFLDLD
NHNAATKRQSSLSASEYLYGTPPPLSSGMGFGSSAFPPHSVMLQTGPPYTPQRPASHFQP
RAYSSPVAALPPHHPGATQPNGLSQEGPIYRCQEEGLGHFQAVMMEQIGTRSGIRGPFQE
MYRPSGMQMHPVQSQASFPKTPTAATSQEEVPPHKPPTLPLDQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q2Z1	0.288	0.293	0.000	1453	0.804	0.821	E9Q2Z1.pdb.gz	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
2	AFDB:Q9BXF3	0.999	0.999	0.000	1484	1.000	1.000	Q9BXF3.pdb.gz	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
3	AFDB:F1RCN2	0.225	0.222	5.319E-56	1502	0.348	0.344	F1RCN2.pdb.gz	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
4	AFDB:Q921C3	0.074	0.048	1.848E-7	2304	0.108	0.069	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
5	AFDB:O60885	0.067	0.073	2.769E-7	1362	0.141	0.153	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
6	AFDB:F1R5H6	0.075	0.077	3.390E-7	1444	0.140	0.144	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
7	AFDB:Q9VC96	0.069	0.047	8.863E-7	2232	0.123	0.082	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
8	AFDB:Q7JVP4	0.082	0.084	1.799E-6	1430	0.094	0.098	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
9	AFDB:Q9ESU6	0.073	0.077	3.472E-6	1400	0.137	0.146	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
10	AFDB:P13709	0.076	0.057	1.938E-5	2038	0.129	0.094	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
11	PDB:1cqxA	0.038	0.090	7.071E-1	403	0.015	0.055	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
12	PDB:4mt6A	0.035	0.092	1.757	389	0.020	0.075	4mt6A.pdb.gz
13	PDB:1cnt1	0.038	0.189	1.848	150	0.016	0.160	1cnt1.pdb.gz
14	PDB:3c98B	0.037	0.181	1.944	230	0.012	0.078	3c98B.pdb.gz
15	PDB:6v8oO	0.056	0.192	2.045	384	0.013	0.052	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
16	PDB:7d5sRN	0.042	0.087	2.634	607	0.022	0.054	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:5apnh	0.032	0.212	3.065	119	0.010	0.126	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:5echB	0.043	0.180	3.391	214	0.012	0.084	5echB.pdb.gz	Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
19	PDB:7cclC	0.045	0.214	3.567	147	0.010	0.102	7cclC.pdb.gz
20	PDB:4px8A	0.029	0.196	3.752	99	0.012	0.182	4px8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q2Z1	0.0	2251	1453	0.803	0.820	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
2	F1RCN2	0.0	611	1502	0.268	0.265	F1RCN2_DANRE CECR2 histone acetyl-lysine reader OS=Danio rerio OX=7955 GN=cecr2 PE=1 SV=1
3	Q9BXF3	0.0	3036	1484	1.000	1.000	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
4	Q9VRY3	2.90e-41	157	342	0.052	0.225	Q9VRY3_DROME Dikar, isoform B OS=Drosophila melanogaster OX=7227 GN=dikar PE=2 SV=2
5	M9PEI6	4.96e-41	169	3261	0.052	0.024	M9PEI6_DROME Dikar, isoform F OS=Drosophila melanogaster OX=7227 GN=dikar PE=1 SV=1
6	Q8IQ71	5.04e-41	169	3080	0.052	0.025	Q8IQ71_DROME Dikar, isoform C OS=Drosophila melanogaster OX=7227 GN=dikar PE=1 SV=2
7	M9MRW0	5.25e-41	169	3222	0.052	0.024	M9MRW0_DROME Dikar, isoform D OS=Drosophila melanogaster OX=7227 GN=dikar PE=1 SV=1
8	Q1LUC3	4.15e-20	99.4	796	0.029	0.054	KAT2B_DANRE Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1
9	A0A0R4IXF6	3.58e-19	96.7	795	0.028	0.052	KAT2A_DANRE Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1
10	Q03330	4.46e-19	94.4	439	0.036	0.121	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
11	Q6P9L3	7.15e-19	95.9	1114	0.027	0.036	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
12	E7F366	7.91e-19	96.3	2899	0.033	0.017	E7F366_DANRE Bromodomain PHD finger transcription factor OS=Danio rerio OX=7955 GN=bptf PE=1 SV=4
13	Q9JHD2	2.52e-18	94.0	830	0.027	0.048	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
14	Q3TMJ3	2.91e-18	93.2	669	0.027	0.060	Q3TMJ3_MOUSE Bptf protein (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
15	Q8VDN7	3.91e-18	92.8	645	0.027	0.062	Q8VDN7_MOUSE Bptf protein (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
16	D4ACX5	4.11e-18	93.2	833	0.027	0.048	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
17	Q92830	4.13e-18	93.2	837	0.027	0.048	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
18	A0A8I6GLB4	8.54e-18	92.8	2982	0.028	0.014	A0A8I6GLB4_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
19	A0A8I5ZVH2	8.86e-18	92.8	3043	0.028	0.013	A0A8I5ZVH2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
20	A0A8I6ALT2	9.85e-18	92.4	2974	0.028	0.014	A0A8I6ALT2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	4.6e-17	73.2	Bromodomain
2	PF02791 DDT	65	15.2	DDT domain
3	PF12238 MSA-2c	1.9e+02	13.5	Merozoite surface antigen 2c
4	PF05132 RNA_pol_Rpc4	8.1e+02	11.8	RNA polymerase III RPC4
5	PF15613 WSD	1.1	21.2	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283131	0.997	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
2	9606.ENSP00000360162	0.990	Probable global transcription activator SNF2L1
3	9606.ENSP00000307208	0.950	Nucleosome-remodeling factor subunit BPTF
4	9606.ENSP00000353458	0.942	Bromodomain adjacent to zinc finger domain protein 1A
5	9606.ENSP00000362592	0.923	Histone-binding protein RBBP4
6	9606.ENSP00000216106	0.902	HMG domain-containing protein 4
7	9606.ENSP00000448598	0.902	Chromatin complexes subunit BAP18
8	9606.ENSP00000325313	0.820	Microtubule-associated protein 1S
9	9606.ENSP00000311513	0.817	Remodeling and spacing factor 1
10	9606.ENSP00000475750	0.816	Heme-binding protein 2
11	9606.ENSP00000260665	0.808	Leucine-rich PPR motif-containing protein, mitochondrial
12	9606.ENSP00000263974	0.806	Transcription initiation factor TFIID subunit 12
13	9606.ENSP00000417510	0.802	SPT20 homolog, SAGA complex component
14	9606.ENSP00000299424	0.796	Transcription initiation factor TFIID subunit 10
15	9606.ENSP00000360515	0.792	Transcription initiation protein SPT3 homolog
16	9606.ENSP00000352925	0.788	Transformation/transcription domain-associated protein
17	9606.ENSP00000307684	0.779	Transcriptional adapter 3
18	9606.ENSP00000337393	0.776	Protein UXT
19	9606.ENSP00000363286	0.734	DNA polymerase epsilon subunit 3
20	9606.ENSP00000287394	0.703	ATPase family AAA domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.999	ATP-dependent activity
GO:0140640	0.999	catalytic activity, acting on a nucleic acid
GO:0005515	0.999	protein binding
GO:0008094	0.991	ATP-dependent activity, acting on DNA
GO:0140658	0.921	ATP-dependent chromatin remodeler activity
GO:0097159	0.553	organic cyclic compound binding
GO:1901363	0.550	heterocyclic compound binding
GO:0003676	0.525	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.987	cellular component organization or biogenesis
GO:0016043	0.970	cellular component organization
GO:0044238	0.961	primary metabolic process
GO:0071704	0.960	organic substance metabolic process
GO:0006807	0.949	nitrogen compound metabolic process
GO:0043170	0.949	macromolecule metabolic process
GO:0006325	0.899	chromatin organization
GO:0006338	0.892	chromatin remodeling
GO:0044237	0.839	cellular metabolic process
GO:0050789	0.623	regulation of biological process
GO:0090304	0.594	nucleic acid metabolic process
GO:0019222	0.550	regulation of metabolic process
GO:0050794	0.468	regulation of cellular process
GO:0060255	0.385	regulation of macromolecule metabolic process
GO:0080090	0.378	regulation of primary metabolic process
GO:0051171	0.376	regulation of nitrogen compound metabolic process
GO:0031323	0.354	regulation of cellular metabolic process
GO:0019219	0.335	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.320	regulation of DNA-templated transcription
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031010	1.000	ISWI-type complex
GO:0031981	0.775	nuclear lumen
GO:0005654	0.480	nucleoplasm
GO:0090537	0.380	CERF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]