StarFunc result for job id Q9BXF6

User Input

>input (653 residues)
MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVV
EKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGV
DKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSASMFDL
SMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKL
RKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSTEGGRDSAQSPKLF
THKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGPVRHRSSISG
SLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHP
GEEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRR
SSLGEKGGPILGASPHHSSSGEEKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPD
RKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHL
THDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXF6	0.999	0.999	1.155E-87	653	1.000	1.000	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
2	AFDB:Q8R361	0.481	0.486	1.707E-74	645	0.858	0.868	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
3	AFDB:Q6WKZ4	0.230	0.122	8.816E-27	1283	0.326	0.166	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
4	PDB:5a50A	0.177	0.639	3.533E-9	165	0.047	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
5	PDB:4rj9A	0.159	0.600	9.161E-9	161	0.055	0.224	4rj9A.pdb.gz
6	PDB:5a52A	0.152	0.588	2.512E-8	154	0.041	0.175	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
7	AFDB:Q57WH0	0.154	0.085	7.246E-8	1241	0.165	0.087	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
8	PDB:1cjyA	0.150	0.155	8.153E-8	633	0.041	0.043	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	PDB:3nsjA	0.145	0.177	9.120E-8	530	0.038	0.047	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
10	PDB:5ixcA	0.153	0.146	1.277E-7	684	0.035	0.034	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
11	PDB:5iz5B	0.153	0.135	1.277E-7	746	0.038	0.034	5iz5B.pdb.gz
12	AFDB:A2AP18	0.158	0.074	2.487E-7	1501	0.173	0.075	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
13	AFDB:Q9P2P5	0.174	0.079	2.630E-7	1572	0.182	0.076	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
14	AFDB:M9PDD2	0.158	0.158	3.682E-7	655	0.136	0.136	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
15	PDB:5iz5A	0.150	0.131	5.483E-7	757	0.037	0.032	5iz5A.pdb.gz
16	PDB:5izrC	0.151	0.149	8.117E-7	659	0.035	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	AFDB:Q4KWH8	0.166	0.068	1.495E-6	1693	0.155	0.060	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
18	AFDB:Q86UR5	0.119	0.051	1.979E-6	1692	0.168	0.065	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
19	PDB:3pfqA	0.127	0.158	2.355E-6	523	0.031	0.038	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	AFDB:O75038	0.168	0.089	2.619E-6	1416	0.168	0.078	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GTL5	0.0	1001	1324	0.801	0.395	A0A1B0GTL5_HUMAN RAB11 family interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
2	Q8R361	0.0	1065	645	0.859	0.870	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
3	Q9BXF6	0.0	1318	653	1.000	1.000	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
4	Q6WKZ4	2.04e-72	256	1283	0.240	0.122	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
5	A0A0R4ID81	6.41e-63	218	478	0.175	0.238	A0A0R4ID81_DANRE RAB11 family-interacting protein 2 (class I) OS=Danio rerio OX=7955 GN=rab11fip2 PE=4 SV=1
6	A0A8I6ASH5	4.02e-59	208	507	0.170	0.219	A0A8I6ASH5_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
7	A0A8I6A6W2	4.43e-59	208	510	0.170	0.218	A0A8I6A6W2_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
8	A0A8I6AF99	4.67e-59	208	512	0.170	0.217	A0A8I6AF99_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
9	G3XA57	5.85e-59	208	512	0.170	0.217	RFIP2_MOUSE Rab11 family-interacting protein 2 OS=Mus musculus OX=10090 GN=Rab11fip2 PE=1 SV=1
10	Q7L804	6.88e-59	208	512	0.164	0.209	RFIP2_HUMAN Rab11 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=RAB11FIP2 PE=1 SV=1
11	D3ZD48	9.78e-59	208	529	0.170	0.210	D3ZD48_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=3
12	A0A8I6A5U7	1.00e-58	208	522	0.170	0.213	A0A8I6A5U7_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
13	A0A8I6A8W0	1.26e-58	208	557	0.170	0.199	A0A8I6A8W0_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=1
14	Q494I2	1.01e-30	127	409	0.119	0.191	Q494I2_DROME GH05001p OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
15	X2JEA7	1.40e-30	126	420	0.118	0.183	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
16	X2JL40	1.46e-29	127	826	0.118	0.093	X2JL40_DROME Rab11 interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
17	X2JFP6	1.50e-29	127	815	0.118	0.094	X2JFP6_DROME Rab11 interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
18	Q9VWS3	2.01e-29	126	832	0.118	0.093	Q9VWS3_DROME Rab11 interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1
19	E7EX40	7.64e-12	70.5	501	0.067	0.088	E7EX40_HUMAN RAB11 family interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=1
20	Q95SD9	1.81e-04	42.4	70	0.032	0.300	Q95SD9_DROME GM01994p OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	6.8e-08	44.1	C2 domain
2	PF09457 RBD-FIP	2.1e-07	42.1	FIP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258098

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.999	Ras-related protein Rab-11A
2	9606.ENSP00000333547	0.957	Ras-related protein Rab-11B
3	9606.ENSP00000354376	0.932	Ras-related protein Rab-25
4	9606.ENSP00000347839	0.915	Rab11 family-interacting protein 2
5	9606.ENSP00000324628	0.877	Gamma-soluble NSF attachment protein
6	9606.ENSP00000262305	0.869	Rab11 family-interacting protein 3
7	9606.ENSP00000479153	0.843	EH domain-containing protein 1
8	9606.ENSP00000331342	0.840	Rab11 family-interacting protein 1
9	9606.ENSP00000482620	0.760	Rab11 family-interacting protein 4
10	9606.ENSP00000366863	0.737	TBC1 domain family member 4
11	9606.ENSP00000272427	0.682	Exocyst complex component 6B
12	9606.ENSP00000460236	0.668	Spondin-1
13	9606.ENSP00000285039	0.649	Unconventional myosin-Vb
14	9606.ENSP00000362946	0.615	Ras-related protein Rab-14
15	9606.ENSP00000317332	0.608	Sorting nexin-18
16	9606.ENSP00000385808	0.598	Kinesin-like protein KIF3A
17	9606.ENSP00000368022	0.596	Optineurin
18	9606.ENSP00000355651	0.591	Ras-related protein Rab-4A
19	9606.ENSP00000245304	0.572	Ras-related protein Rap-2a
20	9606.ENSP00000298316	0.567	ADP-ribosylation factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043015	1.000	gamma-tubulin binding
GO:0019899	0.778	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.986	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0050896	0.971	response to stimulus
GO:0006810	0.957	transport
GO:0010817	0.951	regulation of hormone levels
GO:0051716	0.949	cellular response to stimulus
GO:0051046	0.867	regulation of secretion
GO:1903530	0.772	regulation of secretion by cell
GO:0032880	0.753	regulation of protein localization
GO:0048519	0.737	negative regulation of biological process
GO:0009268	0.726	response to pH
GO:0023051	0.709	regulation of signaling
GO:0048523	0.707	negative regulation of cellular process
GO:0051641	0.686	cellular localization
GO:0016192	0.671	vesicle-mediated transport
GO:0051051	0.665	negative regulation of transport
GO:1903531	0.656	negative regulation of secretion by cell
GO:0140352	0.620	export from cell
GO:0010646	0.556	regulation of cell communication
GO:0009914	0.554	hormone transport
GO:0104004	0.515	cellular response to environmental stimulus
GO:2000008	0.513	regulation of protein localization to cell surface
GO:0010447	0.512	response to acidic pH
GO:0015833	0.509	peptide transport
GO:0046903	0.489	secretion
GO:0051239	0.474	regulation of multicellular organismal process
GO:0045184	0.467	establishment of protein localization
GO:0051649	0.437	establishment of localization in cell
GO:0023057	0.422	negative regulation of signaling
GO:0010648	0.403	negative regulation of cell communication
GO:0050708	0.403	regulation of protein secretion
GO:0048518	0.390	positive regulation of biological process
GO:0023061	0.361	signal release
GO:0015031	0.351	protein transport
GO:0050709	0.347	negative regulation of protein secretion
GO:0046888	0.341	negative regulation of hormone secretion
GO:0046879	0.332	hormone secretion
GO:0071468	0.330	cellular response to acidic pH
GO:0030072	0.321	peptide hormone secretion
GO:0009306	0.312	protein secretion
GO:0051241	0.303	negative regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0016020	0.977	membrane
GO:0005739	0.964	mitochondrion
GO:0005829	0.947	cytosol
GO:0098588	0.938	bounding membrane of organelle
GO:0031982	0.935	vesicle
GO:0043232	0.930	intracellular non-membrane-bounded organelle
GO:0031410	0.927	cytoplasmic vesicle
GO:0005768	0.894	endosome
GO:0055037	0.861	recycling endosome
GO:0012506	0.753	vesicle membrane
GO:0015630	0.708	microtubule cytoskeleton
GO:0005813	0.702	centrosome
GO:0030659	0.699	cytoplasmic vesicle membrane
GO:0034451	0.665	centriolar satellite
GO:0030139	0.656	endocytic vesicle
GO:0071944	0.519	cell periphery
GO:0031967	0.453	organelle envelope
GO:0031981	0.447	nuclear lumen
GO:0005654	0.380	nucleoplasm
GO:0005886	0.368	plasma membrane
GO:0031966	0.309	mitochondrial membrane
GO:0031968	0.301	organelle outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]