StarFunc result for job id Q9BXI2

User Input

>input (301 residues)
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGL
RGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFA
ALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQE
VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVL
SMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXI2	1.000	1.000	9.576E-40	301	1.000	1.000	Q9BXI2.pdb.gz	ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens OX=9606 GN=SLC25A2 PE=1 SV=3
2	AFDB:A0A0G2K309	0.995	0.995	7.758E-35	301	0.847	0.847	A0A0G2K309.pdb.gz	ORNT1_RAT Mitochondrial ornithine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc25a15 PE=1 SV=1
3	AFDB:Q99ML6	0.758	0.850	9.171E-25	265	0.694	0.789	Q99ML6.pdb.gz	Q99ML6_MOUSE Mutant ornithine transporter 2 OS=Mus musculus OX=10090 GN=Slc25a2 PE=2 SV=1
4	AFDB:Q93XM7	0.838	0.840	2.779E-17	300	0.339	0.340	Q93XM7.pdb.gz	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
5	AFDB:O43772	0.779	0.779	2.002E-16	301	0.319	0.319	O43772.pdb.gz	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
6	AFDB:Q84UC7	0.857	0.831	3.606E-16	311	0.319	0.309	Q84UC7.pdb.gz	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
7	AFDB:Q385N9	0.822	0.873	4.449E-16	282	0.272	0.291	Q385N9.pdb.gz	Q385N9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2960 PE=3 SV=1
8	AFDB:Q8N8R3	0.807	0.802	2.709E-15	303	0.312	0.310	Q8N8R3.pdb.gz	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2
9	AFDB:Q12375	0.807	0.830	3.486E-15	292	0.289	0.298	Q12375.pdb.gz	ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORT1 PE=1 SV=2
10	AFDB:Q8BW66	0.832	0.820	5.772E-15	306	0.279	0.275	Q8BW66.pdb.gz	S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus OX=10090 GN=Slc25a48 PE=1 SV=2
11	PDB:4c9qB	0.729	0.754	1.325E-9	290	0.213	0.221	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.748	0.767	2.730E-8	293	0.166	0.171	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.518	0.531	4.958E-7	292	0.209	0.216	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:4f4cA	0.131	0.050	8.205E-2	1250	0.133	0.032	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
15	PDB:3hajA	0.145	0.150	8.924E-2	286	0.083	0.087	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
16	PDB:7p54A	0.141	0.119	9.706E-2	397	0.126	0.096	7p54A.pdb.gz
17	PDB:7p5jA	0.125	0.104	1.101E-1	399	0.163	0.123	7p5jA.pdb.gz
18	PDB:7cz5R	0.200	0.215	1.148E-1	269	0.103	0.115	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
19	PDB:7oseB	0.186	0.164	1.417E-1	377	0.123	0.098	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
20	PDB:5mkkB	0.190	0.124	1.477E-1	577	0.150	0.078	5mkkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K309	0.0	509	301	0.847	0.847	ORNT1_RAT Mitochondrial ornithine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc25a15 PE=1 SV=1
2	Q9BXI2	0.0	615	301	1.000	1.000	ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens OX=9606 GN=SLC25A2 PE=1 SV=3
3	Q9WVD5	0.0	511	301	0.850	0.850	ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus OX=10090 GN=Slc25a15 PE=1 SV=1
4	Q9Y619	0.0	525	301	0.874	0.874	ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens OX=9606 GN=SLC25A15 PE=1 SV=1
5	Q99ML6	6.54e-151	425	265	0.694	0.789	Q99ML6_MOUSE Mutant ornithine transporter 2 OS=Mus musculus OX=10090 GN=Slc25a2 PE=2 SV=1
6	Q93XM7	1.38e-49	168	300	0.352	0.353	MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=BOU PE=1 SV=1
7	Q9Z2Z6	3.98e-43	151	301	0.319	0.319	MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus OX=10090 GN=Slc25a20 PE=1 SV=1
8	P97521	5.31e-43	151	301	0.316	0.316	MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a20 PE=1 SV=1
9	O43772	5.78e-43	151	301	0.322	0.322	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
10	Q27257	9.47e-39	140	312	0.299	0.288	DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans OX=6239 GN=dif-1 PE=2 SV=1
11	Q4WBL9	1.27e-38	140	324	0.342	0.318	Q4WBL9_ASPFU Mitochondrial ornithine carrier protein AmcA/Ort1, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G02760 PE=3 SV=1
12	Q8CFJ7	1.53e-38	139	288	0.292	0.306	S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus OX=10090 GN=Slc25a45 PE=1 SV=1
13	Q385N9	1.86e-38	139	282	0.269	0.287	Q385N9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2960 PE=3 SV=1
14	Q84UC7	2.02e-38	139	311	0.322	0.312	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
15	Q9VQG4	5.39e-36	133	306	0.289	0.284	COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster OX=7227 GN=colt PE=2 SV=1
16	Q8N8R3	1.43e-35	132	303	0.329	0.327	S2529_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens OX=9606 GN=SLC25A29 PE=1 SV=2
17	Q12375	2.43e-35	130	292	0.299	0.308	ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORT1 PE=1 SV=2
18	Q12289	5.04e-35	131	327	0.309	0.284	CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRC1 PE=1 SV=1
19	Q8BL03	1.51e-34	129	306	0.316	0.310	S2529_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus OX=10090 GN=Slc25a29 PE=1 SV=1
20	Q387M4	4.34e-33	125	310	0.289	0.281	Q387M4_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0870 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10041 DUF2277	3.9e+02	12.8	Uncharacterized conserved protein (DUF2277)
2	PF00153 Mito_carr	4.8e-56	198.0	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357838	0.582	Ornithine aminotransferase, mitochondrial
2	9606.ENSP00000268379	0.577	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9606.ENSP00000483781	0.562	CDGSH iron-sulfur domain-containing protein 3, mitochondrial
4	9606.ENSP00000428288	0.543	Protocadherin gamma-B4
5	9606.ENSP00000468980	0.533	Solute carrier family 25 member 53
6	9606.ENSP00000312709	0.526	Transcription initiation factor TFIID subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015174	0.999	basic amino acid transmembrane transporter activity
GO:0015179	0.998	L-amino acid transmembrane transporter activity
GO:0061459	0.994	L-arginine transmembrane transporter activity
GO:0015189	0.993	L-lysine transmembrane transporter activity
GO:0005488	0.924	binding
GO:0005515	0.850	protein binding
GO:0022804	0.516	active transmembrane transporter activity
GO:0015291	0.498	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0055085	0.987	transmembrane transport
GO:1990542	0.980	mitochondrial transmembrane transport
GO:0072337	0.960	modified amino acid transport
GO:0046942	0.955	carboxylic acid transport
GO:0008152	0.946	metabolic process
GO:0006865	0.936	amino acid transport
GO:0015807	0.926	L-amino acid transport
GO:0044237	0.918	cellular metabolic process
GO:0044238	0.857	primary metabolic process
GO:0071704	0.855	organic substance metabolic process
GO:0044281	0.838	small molecule metabolic process
GO:0006807	0.746	nitrogen compound metabolic process
GO:1905039	0.663	carboxylic acid transmembrane transport
GO:0034641	0.642	cellular nitrogen compound metabolic process
GO:0006591	0.638	ornithine metabolic process
GO:1901576	0.618	organic substance biosynthetic process
GO:0003333	0.594	amino acid transmembrane transport
GO:1902475	0.582	L-alpha-amino acid transmembrane transport
GO:0015802	0.566	basic amino acid transport
GO:0043604	0.540	amide biosynthetic process
GO:0071941	0.519	nitrogen cycle metabolic process
GO:1901566	0.427	organonitrogen compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.997	membrane
GO:0031967	0.921	organelle envelope
GO:0031090	0.901	organelle membrane
GO:0005740	0.884	mitochondrial envelope
GO:0019866	0.873	organelle inner membrane
GO:0005743	0.861	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32143	0.994	L-arginine(in) = L-arginine(out)

[back to server]