StarFunc result for job id Q9BXI3

User Input

>input (368 residues)
MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRA
LFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDV
FDIVLMTNNHAQVGVRLINSINHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVR
EAIDEGIAAATIFSPSRDVVVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAH
ENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWG
LETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAP
AKQAPSAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXI3	1.000	1.000	4.471E-73	368	1.000	1.000	Q9BXI3.pdb.gz	5NT1A_HUMAN Cytosolic 5'-nucleotidase 1A OS=Homo sapiens OX=9606 GN=NT5C1A PE=1 SV=1
2	AFDB:A0A0G2JX78	0.863	0.506	3.609E-54	632	0.647	0.377	A0A0G2JX78.pdb.gz	A0A0G2JX78_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=1 SV=1
3	AFDB:Q91YE9	0.866	0.559	2.557E-53	573	0.625	0.401	Q91YE9.pdb.gz	5NT1B_MOUSE Cytosolic 5'-nucleotidase 1B OS=Mus musculus OX=10090 GN=Nt5c1b PE=1 SV=2
4	AFDB:Q96P26	0.833	0.508	3.227E-50	610	0.590	0.356	Q96P26.pdb.gz	5NT1B_HUMAN Cytosolic 5'-nucleotidase 1B OS=Homo sapiens OX=9606 GN=NT5C1B PE=2 SV=2
5	AFDB:A0A0U1RPR8	0.129	0.061	1.002E-3	1117	0.125	0.041	A0A0U1RPR8.pdb.gz	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
6	AFDB:A0A0R4IA41	0.172	0.104	1.336E-3	638	0.117	0.067	A0A0R4IA41.pdb.gz	A0A0R4IA41_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=2
7	PDB:4jb3A	0.214	0.326	3.253E-3	218	0.082	0.138	4jb3A.pdb.gz
8	PDB:4z3dA	0.187	0.238	5.156E-3	276	0.087	0.116	4z3dA.pdb.gz	Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
9	AFDB:Q9LSX7	0.235	0.297	5.323E-3	283	0.076	0.099	Q9LSX7.pdb.gz	PEX22_ARATH Peroxisome biogenesis protein 22 OS=Arabidopsis thaliana OX=3702 GN=PEX22 PE=1 SV=1
10	PDB:7ef7A	0.194	0.283	5.462E-3	236	0.079	0.123	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
11	PDB:3l5kA	0.205	0.303	7.284E-3	233	0.065	0.103	3l5kA.pdb.gz
12	PDB:2b0cA	0.215	0.363	7.716E-3	199	0.068	0.126	2b0cA.pdb.gz	The 2.0A crystal structure of the putative phosphatase from Escherichia coli
13	AFDB:O49195	0.284	0.371	7.966E-3	270	0.060	0.081	O49195.pdb.gz	VSP1_ARATH Vegetative storage protein 1 OS=Arabidopsis thaliana OX=3702 GN=VSP1 PE=1 SV=2
14	AFDB:F1LX86	0.174	0.113	8.438E-3	589	0.103	0.065	F1LX86.pdb.gz	F1LX86_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=4
15	PDB:1n5dA	0.190	0.232	9.171E-3	288	0.095	0.122	1n5dA.pdb.gz	Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
16	AFDB:Q9C550	0.131	0.098	9.468E-3	631	0.103	0.060	Q9C550.pdb.gz	LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPMS2 PE=1 SV=1
17	PDB:2b82A	0.242	0.387	1.090E-2	211	0.065	0.114	2b82A.pdb.gz	A structure-based proposal for the catalytic mechanism of the bacterial acid phosphatase AphA belonging to the DDDD superfamily of phosphohydrolases
18	PDB:4haiA	0.203	0.141	1.090E-2	548	0.076	0.051	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.
19	PDB:5izdA	0.179	0.140	1.454E-2	494	0.076	0.057	5izdA.pdb.gz	Structure of wild-type glyceraldehyde dehydrogenase from Thermoplasma acidophilum in complex with NADP
20	PDB:2hrbA	0.169	0.211	1.631E-2	273	0.087	0.117	2hrbA.pdb.gz	Crystal Structure of human Carbonyl Reductase 3, complexed with NADP+

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZYY7	0.0	641	365	0.848	0.855	A0A8I5ZYY7_RAT 5'-nucleotidase, cytosolic IA OS=Rattus norvegicus OX=10116 GN=Nt5c1a PE=4 SV=1
2	A3KFX0	0.0	697	365	0.948	0.956	5NT1A_MOUSE Cytosolic 5'-nucleotidase 1A OS=Mus musculus OX=10090 GN=Nt5c1a PE=1 SV=1
3	D3ZVD3	0.0	682	362	0.932	0.948	D3ZVD3_RAT 5'-nucleotidase, cytosolic IA OS=Rattus norvegicus OX=10116 GN=Nt5c1a PE=4 SV=1
4	Q9BXI3	0.0	759	368	1.000	1.000	5NT1A_HUMAN Cytosolic 5'-nucleotidase 1A OS=Homo sapiens OX=9606 GN=NT5C1A PE=1 SV=1
5	A0A8I6AG86	1.30e-175	501	544	0.630	0.426	A0A8I6AG86_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=4 SV=1
6	Q6AXN7	2.78e-175	501	574	0.630	0.404	Q6AXN7_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=1 SV=1
7	A0A0G2JX78	3.24e-174	501	632	0.630	0.367	A0A0G2JX78_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=1 SV=1
8	Q91YE9	2.51e-173	496	573	0.625	0.401	5NT1B_MOUSE Cytosolic 5'-nucleotidase 1B OS=Mus musculus OX=10090 GN=Nt5c1b PE=1 SV=2
9	Q96P26	8.09e-161	466	610	0.592	0.357	5NT1B_HUMAN Cytosolic 5'-nucleotidase 1B OS=Homo sapiens OX=9606 GN=NT5C1B PE=2 SV=2
10	Q9VHG1	1.7	33.1	833	0.092	0.041	Q9VHG1_DROME Vacuolar protein sorting-associated protein 16 homolog OS=Drosophila melanogaster OX=7227 GN=Vps16A PE=1 SV=1
11	P35194	5.4	32.0	2493	0.057	0.008	UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP20 PE=1 SV=3
12	Q8N9I5	5.4	31.6	356	0.046	0.048	FADS6_HUMAN Fatty acid desaturase 6 OS=Homo sapiens OX=9606 GN=FADS6 PE=1 SV=2
13	Q9V3Z6	5.6	31.6	2167	0.052	0.009	MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1
14	P75167	7.8	31.2	508	0.060	0.043	GPMI_MYCPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=gpmI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06189 5-nucleotidase	7.1e-103	354.8	5'-nucleotidase
2	PF19708 DUF6205	97	14.7	Family of unknown function (DUF6205)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000235628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245552	0.958	5'(3')-deoxyribonucleotidase, cytosolic type
2	9606.ENSP00000373674	0.948	5'(3')-deoxyribonucleotidase, mitochondrial
3	9606.ENSP00000339479	0.944	Cytosolic purine 5'-nucleotidase
4	9606.ENSP00000286648	0.943	Deoxycytidine kinase
5	9606.ENSP00000236959	0.935	Bifunctional purine biosynthesis protein PURH
6	9606.ENSP00000349576	0.933	Deoxycytidylate deaminase
7	9606.ENSP00000484415	0.933	Cytosolic 5'-nucleotidase 3A
8	9606.ENSP00000354532	0.929	Purine nucleoside phosphorylase
9	9606.ENSP00000286621	0.928	Adenosine kinase
10	9606.ENSP00000361965	0.925	Adenosine deaminase
11	9606.ENSP00000369456	0.925	Inosine triphosphate pyrophosphatase
12	9606.ENSP00000389948	0.924	7-methylguanosine phosphate-specific 5'-nucleotidase
13	9606.ENSP00000485525	0.922	Adenylosuccinate lyase
14	9606.ENSP00000364212	0.921	Cytidine deaminase
15	9606.ENSP00000256722	0.917	UMP-CMP kinase 2, mitochondrial
16	9606.ENSP00000298556	0.912	Hypoxanthine-guanine phosphoribosyltransferase
17	9606.ENSP00000367615	0.910	Adenine phosphoribosyltransferase
18	9606.ENSP00000401508	0.910	Nicotinate phosphoribosyltransferase
19	9606.ENSP00000259727	0.906	GMP reductase 1
20	9606.ENSP00000230792	0.904	Peroxisomal NADH pyrophosphatase NUDT12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008253	1.000	5'-nucleotidase activity
GO:0005488	0.984	binding
GO:0005515	0.971	protein binding
GO:0043167	0.888	ion binding
GO:0046872	0.685	metal ion binding
GO:0000287	0.545	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0006139	0.988	nucleobase-containing compound metabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0055086	0.977	nucleobase-containing small molecule metabolic process
GO:1901135	0.956	carbohydrate derivative metabolic process
GO:0072521	0.938	purine-containing compound metabolic process
GO:0019637	0.900	organophosphate metabolic process
GO:0006796	0.895	phosphate-containing compound metabolic process
GO:0006753	0.890	nucleoside phosphate metabolic process
GO:0009117	0.786	nucleotide metabolic process
GO:0046700	0.762	heterocycle catabolic process
GO:0044270	0.762	cellular nitrogen compound catabolic process
GO:1901361	0.719	organic cyclic compound catabolic process
GO:0019439	0.637	aromatic compound catabolic process
GO:0006163	0.619	purine nucleotide metabolic process
GO:0034655	0.530	nucleobase-containing compound catabolic process
GO:0009150	0.513	purine ribonucleotide metabolic process
GO:1901657	0.446	glycosyl compound metabolic process
GO:0009123	0.379	nucleoside monophosphate metabolic process
GO:1901292	0.378	nucleoside phosphate catabolic process
GO:0009116	0.350	nucleoside metabolic process
GO:0009119	0.333	ribonucleoside metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.788	membrane-bounded organelle
GO:0043231	0.731	intracellular membrane-bounded organelle
GO:0043233	0.445	organelle lumen
GO:0070013	0.438	intracellular organelle lumen
GO:0031981	0.339	nuclear lumen
GO:0005654	0.308	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12484	1.000	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	1.000	5'-nucleotidase.

[back to server]