StarFunc result for job id Q9BXI6

User Input

>input (508 residues)
MAKSNGENGPRAPAAGESLSGTRESLAQGPDAATTDELSSLGSDSEANGFAERRIDKFGF
IVGSQGAEGALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRA
WQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLF
RVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYSEKLEAIQL
DGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFFCEGV
KIIFRVGLVLLKHALGSPEKVKACQGQYETIERLRSLSPKIMQEAFLVQEVVELPVTERQ
IEREHLIQLRRWQETRGELQCRSPPRLHGAKAILDAEPGPRPALQPSPSIRLPLDAPLPG
SKAKPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSA
PQDLAPQVSAHHRSQESLTSQESEDTYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXI6	1.000	1.000	8.281E-65	508	1.000	1.000	Q9BXI6.pdb.gz	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1
2	AFDB:Q4KMP7	0.716	0.456	5.551E-38	808	0.563	0.354	Q4KMP7.pdb.gz	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3
3	AFDB:Q8IV04	0.688	0.780	6.937E-31	446	0.392	0.446	Q8IV04.pdb.gz	TB10C_HUMAN Carabin OS=Homo sapiens OX=9606 GN=TBC1D10C PE=1 SV=1
4	AFDB:Q8C9V1	0.683	0.780	3.123E-30	444	0.376	0.430	Q8C9V1.pdb.gz	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
5	AFDB:Q9VGL8	0.620	0.865	3.192E-25	363	0.297	0.416	Q9VGL8.pdb.gz	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
6	AFDB:A0A384L1W6	0.601	0.854	3.092E-17	353	0.220	0.317	A0A384L1W6.pdb.gz	A0A384L1W6_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g02460 PE=1 SV=1
7	AFDB:Q38A97	0.593	0.716	8.755E-16	418	0.215	0.261	Q38A97.pdb.gz	Q38A97_TRYB2 GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1770 PE=4 SV=1
8	AFDB:H2KZZ6	0.554	0.312	7.990E-14	934	0.193	0.105	H2KZZ6.pdb.gz	TBC11_CAEEL Rab GTPase-activating protein tbc-11 OS=Caenorhabditis elegans OX=6239 GN=tbc-11 PE=1 SV=1
9	AFDB:S6F527	0.532	0.310	1.434E-13	888	0.185	0.106	S6F527.pdb.gz	EAT17_CAEEL Rab GTPase-activating protein eat-17 OS=Caenorhabditis elegans OX=6239 GN=eat-17 PE=1 SV=1
10	AFDB:Q9Y3P9	0.544	0.268	2.575E-13	1069	0.185	0.088	Q9Y3P9.pdb.gz	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
11	PDB:4z6yA	0.359	0.617	2.444E-3	273	0.108	0.201	4z6yA.pdb.gz
12	PDB:4ywtB	0.079	0.089	1.809E-1	431	0.104	0.123	4ywtB.pdb.gz	Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.
13	PDB:1wmwA	0.112	0.145	3.387E-1	328	0.079	0.122	1wmwA.pdb.gz
14	PDB:3o8jA	0.103	0.122	1.138	364	0.077	0.107	3o8jA.pdb.gz
15	PDB:5jwfA	0.105	0.084	1.138	700	0.081	0.059	5jwfA.pdb.gz
16	PDB:1kpkA	0.097	0.104	1.402	450	0.083	0.093	1kpkA.pdb.gz
17	PDB:2azjA	0.098	0.137	1.462	276	0.083	0.152	2azjA.pdb.gz
18	PDB:7ax3A	0.072	0.064	1.590	587	0.061	0.053	7ax3A.pdb.gz	CryoEM structure of the super-constricted two-start dynamin 1 filament.
19	PDB:7y47B	0.096	0.074	1.658	767	0.093	0.061	7y47B.pdb.gz	Structural and mechanistic insights into the precise product synthesis by a bifunctional miltiradiene synthase.
20	PDB:8a3tQ	0.087	0.076	1.728	623	0.069	0.056	8a3tQ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4KMP7	0.0	577	808	0.514	0.323	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3
2	Q9BXI6	0.0	1041	508	1.000	1.000	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1
3	Q8IV04	2.15e-125	375	446	0.344	0.392	TB10C_HUMAN Carabin OS=Homo sapiens OX=9606 GN=TBC1D10C PE=1 SV=1
4	Q8C9V1	1.10e-123	370	444	0.339	0.387	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
5	Q9VGL8	1.07e-102	314	363	0.291	0.408	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
6	A0A384L1W6	4.24e-50	177	353	0.181	0.261	A0A384L1W6_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g02460 PE=1 SV=1
7	F1LJ00	1.76e-42	164	815	0.171	0.107	F1LJ00_HUMAN TBC1 domain family, member 18 OS=Homo sapiens OX=9606 GN=TBC1D18 PE=2 SV=1
8	Q5R372	1.76e-42	164	815	0.171	0.107	RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens OX=9606 GN=RABGAP1L PE=1 SV=1
9	Q38A97	5.82e-42	157	418	0.183	0.222	Q38A97_TRYB2 GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1770 PE=4 SV=1
10	Q9Y3P9	2.42e-38	152	1069	0.157	0.075	RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3
11	P87234	3.42e-38	150	635	0.197	0.157	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
12	Q96CN4	1.66e-34	140	794	0.159	0.102	EVI5L_HUMAN EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1
13	Q9VYY9	9.35e-34	138	807	0.154	0.097	EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3
14	Q92738	1.59e-33	137	828	0.173	0.106	US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3
15	H2KZZ6	7.04e-33	135	934	0.159	0.087	TBC11_CAEEL Rab GTPase-activating protein tbc-11 OS=Caenorhabditis elegans OX=6239 GN=tbc-11 PE=1 SV=1
16	O60447	1.64e-32	134	810	0.148	0.093	EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3
17	Q0IIM8	4.55e-32	133	1120	0.156	0.071	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
18	Q6ZT07	6.54e-32	132	1266	0.156	0.062	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
19	Q66K14	7.07e-32	132	1250	0.171	0.070	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
20	A1L3A9	7.41e-32	132	1232	0.171	0.071	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	99	14.9	Leucine rich repeat C-terminal domain
2	PF00566 RabGAP-TBC	5.7e-49	178.2	Rab-GTPase-TBC domain
3	PF16031 TonB_N	3.6e+02	13.1	TonB polyproline region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229340	0.989	Ras-related protein Rab-35
2	9606.ENSP00000262613	0.965	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
3	9606.ENSP00000440704	0.843	Synaptotagmin-like protein 1
4	9606.ENSP00000408005	0.833	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
5	9606.ENSP00000298316	0.810	ADP-ribosylation factor 6
6	9606.ENSP00000356042	0.785	Ezrin
7	9606.ENSP00000244040	0.755	Ras-related protein Rab-22A
8	9606.ENSP00000379601	0.749	Ras-related protein Rab-27A
9	9606.ENSP00000353549	0.644	Cell division cycle protein 16 homolog
10	9606.ENSP00000248342	0.641	Eukaryotic translation initiation factor 3 subunit K
11	9606.ENSP00000361731	0.641	TBC1 domain family member 13
12	9606.ENSP00000471604	0.618	Testis-expressed protein 13A
13	9606.ENSP00000261890	0.610	Ras-related protein Rab-11A
14	9606.ENSP00000311449	0.599	Ras-related protein Rab-6A
15	9606.ENSP00000362590	0.595	TBC1 domain family member 22B
16	9606.ENSP00000262646	0.592	Ras-related protein Rab-2A
17	9606.ENSP00000262094	0.566	Ras-related protein Rab-27B
18	9606.ENSP00000268989	0.556	Small G protein signaling modulator 2
19	9606.ENSP00000479816	0.532	DENN domain-containing protein 1B
20	9606.ENSP00000369636	0.517	PX domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0030165	1.000	PDZ domain binding
GO:0098772	0.829	molecular function regulator activity
GO:0140677	0.726	molecular function activator activity
GO:0030695	0.719	GTPase regulator activity
GO:0019899	0.459	enzyme binding
GO:0008047	0.403	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0009987	0.993	cellular process
GO:0051179	0.983	localization
GO:0050789	0.978	regulation of biological process
GO:0051336	0.971	regulation of hydrolase activity
GO:0051234	0.970	establishment of localization
GO:0048518	0.956	positive regulation of biological process
GO:0019222	0.950	regulation of metabolic process
GO:0016192	0.938	vesicle-mediated transport
GO:0051641	0.910	cellular localization
GO:0051649	0.897	establishment of localization in cell
GO:0016197	0.894	endosomal transport
GO:0060255	0.880	regulation of macromolecule metabolic process
GO:0051246	0.805	regulation of protein metabolic process
GO:0009893	0.795	positive regulation of metabolic process
GO:0008152	0.765	metabolic process
GO:0016482	0.754	cytosolic transport
GO:0051345	0.753	positive regulation of hydrolase activity
GO:0010604	0.745	positive regulation of macromolecule metabolic process
GO:0071704	0.716	organic substance metabolic process
GO:0051247	0.715	positive regulation of protein metabolic process
GO:0042147	0.713	retrograde transport, endosome to Golgi
GO:0044238	0.685	primary metabolic process
GO:0006807	0.667	nitrogen compound metabolic process
GO:0043170	0.657	macromolecule metabolic process
GO:0051604	0.648	protein maturation
GO:0031638	0.642	zymogen activation
GO:0050794	0.618	regulation of cellular process
GO:2000116	0.591	regulation of cysteine-type endopeptidase activity
GO:2001056	0.584	positive regulation of cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0120025	0.998	plasma membrane bounded cell projection
GO:0031982	0.998	vesicle
GO:0005576	0.996	extracellular region
GO:0043230	0.987	extracellular organelle
GO:0065010	0.979	extracellular membrane-bounded organelle
GO:0098858	0.966	actin-based cell projection
GO:1903561	0.966	extracellular vesicle
GO:0005615	0.941	extracellular space
GO:0070062	0.934	extracellular exosome
GO:0005622	0.928	intracellular anatomical structure
GO:0031410	0.880	cytoplasmic vesicle
GO:0005902	0.697	microvillus
GO:0012505	0.680	endomembrane system
GO:0005829	0.479	cytosol
GO:0098590	0.461	plasma membrane region
GO:0012506	0.363	vesicle membrane
GO:0098588	0.330	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]