StarFunc result for job id Q9BXI9

User Input

>input (278 residues)
MQWLRVRESPGEATGHRVTMGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCC
DSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEP
GPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMAT
GQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAY
GDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXI9	1.000	1.000	6.946E-47	278	1.000	1.000	Q9BXI9.pdb.gz	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
2	AFDB:Q9QXP7	0.582	0.576	1.176E-26	281	0.446	0.441	Q9QXP7.pdb.gz	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
3	AFDB:Q9BXJ1	0.667	0.660	1.466E-25	281	0.442	0.438	Q9BXJ1.pdb.gz	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
4	AFDB:Q4ZJM9	0.450	0.523	1.908E-15	238	0.237	0.277	Q4ZJM9.pdb.gz	C1QL4_MOUSE Complement C1q-like protein 4 OS=Mus musculus OX=10090 GN=C1ql4 PE=1 SV=1
5	AFDB:Q9BXJ4	0.447	0.502	3.228E-15	246	0.245	0.276	Q9BXJ4.pdb.gz	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
6	AFDB:O75973	0.450	0.483	4.198E-15	258	0.248	0.267	O75973.pdb.gz	C1QRF_HUMAN C1q-related factor OS=Homo sapiens OX=9606 GN=C1QL1 PE=1 SV=1
7	AFDB:P02747	0.433	0.488	1.335E-14	245	0.237	0.269	P02747.pdb.gz	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
8	AFDB:Q3Y5Z3	0.490	0.557	1.736E-14	240	0.237	0.275	Q3Y5Z3.pdb.gz	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
9	AFDB:Q5RJ80	0.468	0.150	4.026E-14	914	0.237	0.072	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
10	AFDB:P02745	0.451	0.505	6.130E-14	245	0.263	0.298	P02745.pdb.gz	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
11	PDB:5kc6B	0.395	0.733	2.945E-10	144	0.137	0.264	5kc6B.pdb.gz
12	PDB:5h4bA	0.405	0.790	1.352E-9	136	0.140	0.287	5h4bA.pdb.gz
13	PDB:7e57B	0.306	0.639	3.485E-4	123	0.050	0.114	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:5a3oA	0.248	0.518	6.618E-3	114	0.047	0.114	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
15	PDB:4uybA	0.162	0.124	1.535E-2	401	0.043	0.030	4uybA.pdb.gz
16	PDB:6oj0A	0.240	0.332	1.797E-2	178	0.050	0.079	6oj0A.pdb.gz
17	PDB:4kncB	0.167	0.126	2.104E-2	419	0.079	0.053	4kncB.pdb.gz
18	PDB:2waaA	0.136	0.120	2.463E-2	335	0.058	0.048	2waaA.pdb.gz
19	PDB:4tlgA	0.174	0.130	2.463E-2	396	0.058	0.040	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:5jovA	0.190	0.068	3.377E-2	949	0.083	0.024	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXI9	0.0	582	278	1.000	1.000	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
2	Q6IR41	4.13e-126	361	264	0.647	0.682	C1QT6_MOUSE Complement C1q tumor necrosis factor-related protein 6 OS=Mus musculus OX=10090 GN=C1qtnf6 PE=2 SV=1
3	P60827	3.11e-80	244	252	0.432	0.476	C1QT8_HUMAN Complement C1q tumor necrosis factor-related protein 8 OS=Homo sapiens OX=9606 GN=C1QTNF8 PE=1 SV=2
4	Q9QXP7	6.13e-77	237	281	0.442	0.438	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
5	Q9BXJ1	5.69e-76	234	281	0.428	0.423	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
6	A8K660	1.04e-21	93.2	244	0.237	0.270	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
7	Q15848	1.04e-21	93.2	244	0.237	0.270	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
8	Q3Y5Z3	1.59e-20	89.7	240	0.230	0.267	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
9	Q60994	2.11e-20	89.7	247	0.209	0.235	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
10	Q8K3R4	4.01e-20	89.0	244	0.205	0.234	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
11	Q9ES30	6.52e-20	88.2	246	0.209	0.236	C1QT3_MOUSE Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1
12	Q9BXJ4	3.77e-19	86.3	246	0.209	0.236	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
13	P02745	1.41e-17	82.0	245	0.237	0.269	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
14	Q9BXJ5	3.59e-15	75.9	285	0.194	0.189	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
15	P31720	5.64e-15	74.7	245	0.259	0.294	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
16	Q9BXJ3	6.47e-15	75.9	329	0.205	0.173	C1QT4_HUMAN Complement C1q tumor necrosis factor-related protein 4 OS=Homo sapiens OX=9606 GN=C1QTNF4 PE=1 SV=2
17	Q9D8U4	2.26e-14	73.6	294	0.194	0.184	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
18	Q8BVD7	2.41e-14	73.6	289	0.216	0.208	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
19	P98086	4.36e-14	72.4	245	0.252	0.286	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
20	D3ZJ76	5.27e-14	73.2	331	0.194	0.163	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	2.3e-34	129.7	C1q domain
2	PF01391 Collagen	0.00039	31.4	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356599	0.633	Torsin-3A
2	9606.ENSP00000317327	0.625	Ubiquitin-associated and SH3 domain-containing protein A
3	9606.ENSP00000064571	0.593	Cerebellin-4
4	9606.ENSP00000420927	0.570	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
5	9606.ENSP00000352833	0.560	Tyrosine-protein phosphatase non-receptor type 22
6	9606.ENSP00000354305	0.540	Zinc finger and SCAN domain-containing protein 12
7	9606.ENSP00000220166	0.537	Pro-cathepsin H
8	9606.ENSP00000261745	0.520	N-alpha-acetyltransferase 25, NatB auxiliary subunit
9	9606.ENSP00000428876	0.519	Protein FAM83A
10	9606.ENSP00000338629	0.517	Arginine-glutamic acid dipeptide repeats protein
11	9606.ENSP00000227868	0.500	Pyruvate dehydrogenase protein X component, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0009987	0.882	cellular process
GO:0048583	0.861	regulation of response to stimulus
GO:0048522	0.756	positive regulation of cellular process
GO:0019222	0.744	regulation of metabolic process
GO:0048519	0.738	negative regulation of biological process
GO:0023051	0.663	regulation of signaling
GO:0010646	0.662	regulation of cell communication
GO:0010647	0.596	positive regulation of cell communication
GO:0023056	0.532	positive regulation of signaling
GO:0050896	0.507	response to stimulus
GO:0065008	0.337	regulation of biological quality
GO:0048523	0.319	negative regulation of cellular process
GO:0080090	0.309	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0032991	0.909	protein-containing complex
GO:0043227	0.818	membrane-bounded organelle
GO:0071944	0.690	cell periphery
GO:0016020	0.382	membrane
GO:0005622	0.329	intracellular anatomical structure
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]