StarFunc result for job id Q9BXJ1

User Input

>input (281 residues)
MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKY
RPSQDQGLPASRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAG
ARGHTGPKGQKGSMGAPGERCKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNM
FTGKFYCYVPGLYFFSLNVHTWNQKETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLEL
REQDQVWVRLYKGERENAIFSEELDTYITFSGYLVKHATEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXJ1	1.000	1.000	2.269E-44	281	1.000	1.000	Q9BXJ1.pdb.gz	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
2	AFDB:Q9QXP7	0.683	0.683	6.313E-38	281	0.776	0.776	Q9QXP7.pdb.gz	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
3	AFDB:P60827	0.628	0.695	8.171E-26	252	0.431	0.480	P60827.pdb.gz	C1QT8_HUMAN Complement C1q tumor necrosis factor-related protein 8 OS=Homo sapiens OX=9606 GN=C1QTNF8 PE=1 SV=2
4	AFDB:P02747	0.420	0.479	1.115E-13	245	0.199	0.229	P02747.pdb.gz	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
5	AFDB:Q5RJ80	0.457	0.148	3.739E-13	914	0.224	0.069	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
6	AFDB:Q6IMN6	0.437	0.114	4.154E-13	1127	0.214	0.053	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
7	AFDB:Q8K479	0.477	0.543	7.031E-13	243	0.210	0.243	Q8K479.pdb.gz	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
8	AFDB:P02746	0.430	0.469	1.190E-12	253	0.224	0.249	P02746.pdb.gz	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
9	AFDB:P31721	0.428	0.473	1.469E-12	253	0.181	0.202	P31721.pdb.gz	C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus OX=10116 GN=C1qb PE=1 SV=2
10	AFDB:P14106	0.425	0.469	4.207E-12	253	0.203	0.225	P14106.pdb.gz	C1QB_MOUSE Complement C1q subcomponent subunit B OS=Mus musculus OX=10090 GN=C1qb PE=1 SV=2
11	PDB:5kc6B	0.374	0.706	1.910E-9	144	0.121	0.236	5kc6B.pdb.gz
12	PDB:5h4bA	0.379	0.757	2.484E-9	136	0.132	0.272	5h4bA.pdb.gz
13	PDB:7e57B	0.275	0.595	1.096E-3	123	0.050	0.114	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:6oj0A	0.246	0.353	8.533E-3	178	0.039	0.062	6oj0A.pdb.gz
15	PDB:4fixA	0.206	0.107	1.605E-2	629	0.075	0.033	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:2waaA	0.169	0.148	2.444E-2	335	0.043	0.036	2waaA.pdb.gz
17	PDB:4uybA	0.148	0.115	2.577E-2	401	0.043	0.030	4uybA.pdb.gz
18	PDB:4tlgA	0.157	0.117	2.862E-2	396	0.050	0.035	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:1olmE	0.138	0.107	3.180E-2	397	0.039	0.028	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
20	PDB:5a3oA	0.236	0.482	4.361E-2	114	0.043	0.105	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXJ1	0.0	591	281	1.000	1.000	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
2	Q9QXP7	4.34e-155	435	281	0.776	0.776	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
3	Q6IR41	2.17e-81	248	264	0.434	0.462	C1QT6_MOUSE Complement C1q tumor necrosis factor-related protein 6 OS=Mus musculus OX=10090 GN=C1qtnf6 PE=2 SV=1
4	P60827	7.10e-78	238	252	0.423	0.472	C1QT8_HUMAN Complement C1q tumor necrosis factor-related protein 8 OS=Homo sapiens OX=9606 GN=C1QTNF8 PE=1 SV=2
5	Q9BXI9	3.85e-76	235	278	0.423	0.428	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
6	Q3Y5Z3	1.30e-29	114	240	0.231	0.271	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
7	Q60994	3.53e-28	110	247	0.228	0.259	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
8	Q8K3R4	3.75e-27	107	244	0.221	0.254	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
9	A8K660	3.70e-25	102	244	0.221	0.254	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q15848	3.70e-25	102	244	0.221	0.254	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
11	P98086	5.75e-20	88.6	245	0.203	0.233	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
12	Q9BXJ0	6.80e-20	88.2	243	0.203	0.235	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
13	P02745	7.90e-20	88.2	245	0.221	0.253	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
14	Q9D8U4	1.00e-19	88.6	294	0.224	0.214	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
15	P31720	1.11e-19	87.8	245	0.199	0.229	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
16	D3ZJ76	1.49e-19	89.0	331	0.210	0.178	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
17	Q8K479	1.52e-19	87.4	243	0.199	0.230	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
18	Q4ZJN1	5.48e-19	87.4	333	0.206	0.174	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
19	Q9BXJ5	1.08e-18	85.9	285	0.217	0.214	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
20	Q504F7	1.77e-18	84.3	247	0.249	0.283	Q504F7_DANRE Complement C1q subcomponent subunit A precursor OS=Danio rerio OX=7955 GN=zgc:109903 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	2.9e-34	129.4	C1q domain
2	PF01391 Collagen	6.1e-05	34.0	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340864

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351805	0.802	Vasopressin V2 receptor
2	9606.ENSP00000356599	0.706	Torsin-3A
3	9606.ENSP00000442304	0.658	Erythroferrone
4	9606.ENSP00000384719	0.648	Visinin-like protein 1
5	9606.ENSP00000473983	0.589	Transmembrane protein 120A
6	9606.ENSP00000254667	0.584	Receptor-type tyrosine-protein phosphatase epsilon
7	9606.ENSP00000329137	0.571	Adipolin
8	9606.ENSP00000386200	0.546	Forkhead box protein P2
9	9606.ENSP00000064571	0.529	Cerebellin-4
10	9606.ENSP00000267406	0.511	Cerebellin-3
11	9606.ENSP00000312506	0.511	Chondroitin sulfate proteoglycan 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005518	1.000	collagen binding
GO:0042802	0.502	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.956	positive regulation of biological process
GO:0048522	0.861	positive regulation of cellular process
GO:0050878	0.841	regulation of body fluid levels
GO:0019222	0.838	regulation of metabolic process
GO:0048583	0.831	regulation of response to stimulus
GO:0030155	0.797	regulation of cell adhesion
GO:0022407	0.782	regulation of cell-cell adhesion
GO:0048523	0.746	negative regulation of cellular process
GO:0023051	0.739	regulation of signaling
GO:0023056	0.717	positive regulation of signaling
GO:0010647	0.717	positive regulation of cell communication
GO:0051241	0.714	negative regulation of multicellular organismal process
GO:0080134	0.695	regulation of response to stress
GO:0010817	0.687	regulation of hormone levels
GO:0061041	0.680	regulation of wound healing
GO:0009987	0.641	cellular process
GO:0051049	0.618	regulation of transport
GO:0032101	0.605	regulation of response to external stimulus
GO:0061045	0.576	negative regulation of wound healing
GO:0046883	0.564	regulation of hormone secretion
GO:1903532	0.558	positive regulation of secretion by cell
GO:0030193	0.542	regulation of blood coagulation
GO:1900047	0.539	negative regulation of hemostasis
GO:0044057	0.474	regulation of system process
GO:0032370	0.466	positive regulation of lipid transport
GO:0030195	0.423	negative regulation of blood coagulation
GO:0050865	0.408	regulation of cell activation
GO:0046887	0.406	positive regulation of hormone secretion
GO:0034110	0.391	regulation of homotypic cell-cell adhesion
GO:0044060	0.382	regulation of endocrine process
GO:0010543	0.363	regulation of platelet activation
GO:0060255	0.356	regulation of macromolecule metabolic process
GO:0051240	0.356	positive regulation of multicellular organismal process
GO:0050896	0.350	response to stimulus
GO:0080090	0.320	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005886	0.987	plasma membrane
GO:0043226	0.521	organelle
GO:0043227	0.342	membrane-bounded organelle
GO:0043231	0.329	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]