StarFunc result for job id Q9BXJ3

User Input

>input (329 residues)
MLPLLLGLLGPAACWALGPTPGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGD
FDVATGQFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQ
SAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPPAPPEPRSAFS
AARTRSLVGSDAGPGPRHQPLAFDTEFVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPR
KTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNH
GKYITFSGFLVYPDLAPAAPPGLGASELL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXJ3	1.000	1.000	6.576E-65	329	1.000	1.000	Q9BXJ3.pdb.gz	C1QT4_HUMAN Complement C1q tumor necrosis factor-related protein 4 OS=Homo sapiens OX=9606 GN=C1QTNF4 PE=1 SV=2
2	AFDB:Q9QXP7	0.399	0.465	7.204E-14	281	0.173	0.203	Q9QXP7.pdb.gz	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
3	AFDB:P60827	0.395	0.512	4.248E-13	252	0.191	0.250	P60827.pdb.gz	C1QT8_HUMAN Complement C1q tumor necrosis factor-related protein 8 OS=Homo sapiens OX=9606 GN=C1QTNF8 PE=1 SV=2
4	AFDB:Q9BXJ1	0.389	0.453	8.820E-13	281	0.161	0.189	Q9BXJ1.pdb.gz	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
5	AFDB:Q9BXI9	0.401	0.473	1.206E-12	278	0.179	0.212	Q9BXI9.pdb.gz	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
6	AFDB:Q6IR41	0.381	0.470	2.780E-12	264	0.155	0.193	Q6IR41.pdb.gz	C1QT6_MOUSE Complement C1q tumor necrosis factor-related protein 6 OS=Mus musculus OX=10090 GN=C1qtnf6 PE=2 SV=1
7	AFDB:Q6IMN6	0.376	0.112	1.263E-11	1127	0.182	0.053	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
8	AFDB:Q5RJ80	0.379	0.140	1.402E-11	914	0.179	0.065	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
9	AFDB:Q9BXJ4	0.381	0.506	1.402E-11	246	0.161	0.215	Q9BXJ4.pdb.gz	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
10	AFDB:Q05A80	0.380	0.125	1.477E-11	1031	0.185	0.059	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
11	PDB:5kc6B	0.366	0.802	6.759E-11	144	0.137	0.312	5kc6B.pdb.gz
12	PDB:5h4bA	0.355	0.821	2.748E-9	136	0.128	0.309	5h4bA.pdb.gz
13	PDB:6vlsD	0.164	0.070	3.455E-4	963	0.082	0.028	6vlsD.pdb.gz
14	PDB:5eiyB	0.177	0.100	4.726E-4	658	0.143	0.071	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:7l2zF	0.185	0.105	9.313E-4	664	0.097	0.048	7l2zF.pdb.gz
16	PDB:7e57B	0.241	0.590	1.148E-3	123	0.052	0.138	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
17	PDB:4nhyA	0.097	0.077	1.569E-3	461	0.079	0.056	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
18	PDB:2vvfA	0.233	0.261	6.422E-3	269	0.094	0.115	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
19	PDB:3fz3A	0.160	0.144	7.511E-3	388	0.106	0.090	3fz3A.pdb.gz	Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.
20	PDB:6l4cB	0.111	0.105	7.913E-3	373	0.085	0.075	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXJ3	0.0	664	329	1.000	1.000	C1QT4_HUMAN Complement C1q tumor necrosis factor-related protein 4 OS=Homo sapiens OX=9606 GN=C1QTNF4 PE=1 SV=2
2	Q9QXP7	6.75e-22	95.5	281	0.170	0.199	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
3	P60827	1.92e-20	90.9	252	0.198	0.258	C1QT8_HUMAN Complement C1q tumor necrosis factor-related protein 8 OS=Homo sapiens OX=9606 GN=C1QTNF8 PE=1 SV=2
4	Q05A80	3.11e-18	87.8	1031	0.191	0.061	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
5	Q9BXJ1	4.54e-18	84.7	281	0.155	0.181	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
6	Q6IMN6	5.71e-18	87.0	1127	0.182	0.053	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
7	Q5RJ80	1.10e-17	86.3	914	0.173	0.062	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
8	Q9BXJ0	6.98e-17	80.9	243	0.158	0.214	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
9	Q9BXJ5	3.42e-16	79.7	285	0.164	0.189	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
10	A8K660	3.81e-16	79.0	244	0.140	0.189	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
11	Q15848	3.81e-16	79.0	244	0.140	0.189	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
12	Q9BXI9	6.01e-16	79.0	278	0.185	0.219	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
13	Q9D8U4	8.15e-16	78.6	294	0.167	0.187	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
14	Q8K479	1.15e-15	77.4	243	0.152	0.206	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
15	Q60994	1.83e-14	73.9	247	0.137	0.182	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
16	Q3Y5Z3	2.96e-14	73.6	240	0.134	0.183	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
17	P31722	4.02e-14	73.2	245	0.116	0.155	C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus OX=10116 GN=C1qc PE=1 SV=2
18	O88992	4.24e-14	73.2	258	0.152	0.194	C1QRF_MOUSE C1q-related factor OS=Mus musculus OX=10090 GN=C1ql1 PE=1 SV=2
19	O75973	4.40e-14	73.2	258	0.152	0.194	C1QRF_HUMAN C1q-related factor OS=Homo sapiens OX=9606 GN=C1QL1 PE=1 SV=1
20	Q8K3R4	4.45e-14	72.8	244	0.134	0.180	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	18	16.6	BclA C-terminal domain
2	PF00386 C1q	2e-68	239.9	C1q domain
3	PF09284 RhgB_N	2.8e+02	12.4	Rhamnogalacturonan lyase B, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356599	0.726	Torsin-3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.994	regulation of biological process
GO:0050794	0.920	regulation of cellular process
GO:0048584	0.910	positive regulation of response to stimulus
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0010604	0.855	positive regulation of macromolecule metabolic process
GO:0023051	0.790	regulation of signaling
GO:0010646	0.790	regulation of cell communication
GO:0009987	0.779	cellular process
GO:1902531	0.756	regulation of intracellular signal transduction
GO:0010468	0.725	regulation of gene expression
GO:0048522	0.715	positive regulation of cellular process
GO:0051240	0.660	positive regulation of multicellular organismal process
GO:0001817	0.649	regulation of cytokine production
GO:0032680	0.639	regulation of tumor necrosis factor production
GO:0001959	0.639	regulation of cytokine-mediated signaling pathway
GO:0032675	0.632	regulation of interleukin-6 production
GO:0060760	0.631	positive regulation of response to cytokine stimulus
GO:0001819	0.621	positive regulation of cytokine production
GO:0010647	0.587	positive regulation of cell communication
GO:0023056	0.586	positive regulation of signaling
GO:1901222	0.585	regulation of NIK/NF-kappaB signaling
GO:0009967	0.579	positive regulation of signal transduction
GO:1902533	0.539	positive regulation of intracellular signal transduction
GO:0032755	0.497	positive regulation of interleukin-6 production
GO:0032760	0.485	positive regulation of tumor necrosis factor production
GO:1901224	0.477	positive regulation of NIK/NF-kappaB signaling
GO:0001961	0.463	positive regulation of cytokine-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.994	extracellular space
GO:0043227	0.810	membrane-bounded organelle
GO:0005622	0.686	intracellular anatomical structure
GO:0005737	0.505	cytoplasm
GO:0043231	0.442	intracellular membrane-bounded organelle
GO:0005634	0.355	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]