StarFunc result for job id Q9BXJ4

User Input

>input (246 residues)
MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPG
PPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAF
MASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYV
YLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGF
LLFETK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXJ4	1.000	1.000	4.174E-43	246	1.000	1.000	Q9BXJ4.pdb.gz	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
2	AFDB:Q9BXI9	0.501	0.446	5.033E-16	278	0.276	0.245	Q9BXI9.pdb.gz	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
3	AFDB:Q6IMN6	0.521	0.116	8.193E-16	1127	0.268	0.059	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
4	AFDB:Q5RJ80	0.535	0.150	1.486E-15	914	0.260	0.070	Q5RJ80.pdb.gz	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
5	AFDB:Q05A80	0.525	0.130	1.569E-15	1031	0.260	0.062	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
6	AFDB:Q6IR41	0.500	0.468	2.171E-15	264	0.256	0.239	Q6IR41.pdb.gz	C1QT6_MOUSE Complement C1q tumor necrosis factor-related protein 6 OS=Mus musculus OX=10090 GN=C1qtnf6 PE=2 SV=1
7	AFDB:Q4ZJM9	0.499	0.515	3.347E-15	238	0.301	0.311	Q4ZJM9.pdb.gz	C1QL4_MOUSE Complement C1q-like protein 4 OS=Mus musculus OX=10090 GN=C1ql4 PE=1 SV=1
8	AFDB:Q9QXP7	0.499	0.439	5.448E-15	281	0.276	0.242	Q9QXP7.pdb.gz	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
9	AFDB:O75973	0.502	0.479	1.043E-14	258	0.285	0.271	O75973.pdb.gz	C1QRF_HUMAN C1q-related factor OS=Homo sapiens OX=9606 GN=C1QL1 PE=1 SV=1
10	AFDB:Q9BXJ1	0.503	0.443	1.101E-14	281	0.240	0.210	Q9BXJ1.pdb.gz	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
11	PDB:5kc6B	0.488	0.810	2.850E-12	144	0.179	0.306	5kc6B.pdb.gz
12	PDB:5h4bA	0.478	0.837	1.229E-11	136	0.175	0.316	5h4bA.pdb.gz
13	PDB:7e57B	0.320	0.604	4.321E-4	123	0.049	0.098	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:7l2zF	0.232	0.100	3.568E-3	664	0.045	0.017	7l2zF.pdb.gz
15	PDB:3i26D	0.226	0.168	1.308E-2	369	0.049	0.033	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
16	PDB:5a3oA	0.270	0.508	1.911E-2	114	0.049	0.105	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
17	PDB:5jovA	0.215	0.072	1.911E-2	949	0.065	0.017	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
18	PDB:2waaA	0.179	0.141	2.017E-2	335	0.037	0.027	2waaA.pdb.gz
19	PDB:4fixA	0.287	0.131	3.658E-2	629	0.057	0.022	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
20	PDB:3cl5A	0.253	0.189	3.862E-2	358	0.073	0.050	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXJ4	0.0	511	246	1.000	1.000	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
2	Q9ES30	1.80e-145	408	246	0.959	0.959	C1QT3_MOUSE Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1
3	Q05A80	2.23e-25	106	1031	0.211	0.050	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
4	Q5RJ80	2.44e-25	106	914	0.228	0.061	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
5	Q60994	4.12e-25	101	247	0.285	0.283	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
6	Q6IMN6	1.09e-24	104	1127	0.207	0.045	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
7	Q8K3R4	1.40e-24	99.8	244	0.276	0.279	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
8	A8K660	2.21e-23	96.7	244	0.285	0.287	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
9	Q15848	2.21e-23	96.7	244	0.285	0.287	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q3Y5Z3	2.36e-23	96.7	240	0.268	0.275	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
11	Q9BXI9	7.40e-23	95.9	278	0.313	0.277	C1QT6_HUMAN Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens OX=9606 GN=C1QTNF6 PE=1 SV=4
12	Q6IR41	3.71e-22	94.0	264	0.289	0.269	C1QT6_MOUSE Complement C1q tumor necrosis factor-related protein 6 OS=Mus musculus OX=10090 GN=C1qtnf6 PE=2 SV=1
13	P0C862	4.68e-22	94.7	333	0.289	0.213	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
14	B2RNN3	1.80e-21	93.2	333	0.280	0.207	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
15	D3ZJ76	2.74e-21	92.8	331	0.276	0.205	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
16	Q4ZJN1	5.05e-21	92.0	333	0.272	0.201	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
17	Q8BVD7	1.50e-18	84.7	289	0.264	0.225	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
18	Q9D8U4	2.80e-18	84.0	294	0.236	0.197	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
19	Q9QXP7	3.00e-18	83.6	281	0.268	0.235	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
20	Q8K479	6.83e-18	82.0	243	0.272	0.276	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	4.1e-31	119.2	C1q domain
2	PF01391 Collagen	3.2e-07	41.3	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000010188

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000000773	0.691	Leucine rich repeat containing 61
2	9555.ENSPANP00000009733	0.562	NADH:ubiquinone oxidoreductase subunit A13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051049	0.968	regulation of transport
GO:0006109	0.966	regulation of carbohydrate metabolic process
GO:0062012	0.965	regulation of small molecule metabolic process
GO:0010906	0.964	regulation of glucose metabolic process
GO:0043255	0.962	regulation of carbohydrate biosynthetic process
GO:0009892	0.952	negative regulation of metabolic process
GO:0048518	0.951	positive regulation of biological process
GO:0023051	0.947	regulation of signaling
GO:0010646	0.947	regulation of cell communication
GO:0050896	0.939	response to stimulus
GO:0048583	0.924	regulation of response to stimulus
GO:0045912	0.896	negative regulation of carbohydrate metabolic process
GO:0006111	0.896	regulation of gluconeogenesis
GO:0048523	0.884	negative regulation of cellular process
GO:0009987	0.882	cellular process
GO:0048522	0.871	positive regulation of cellular process
GO:0062014	0.868	negative regulation of small molecule metabolic process
GO:1902531	0.867	regulation of intracellular signal transduction
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0010468	0.864	regulation of gene expression
GO:0051223	0.853	regulation of protein transport
GO:0051046	0.834	regulation of secretion
GO:1903530	0.815	regulation of secretion by cell
GO:0050708	0.803	regulation of protein secretion
GO:0009893	0.793	positive regulation of metabolic process
GO:0010605	0.787	negative regulation of macromolecule metabolic process
GO:0010604	0.772	positive regulation of macromolecule metabolic process
GO:0043410	0.772	positive regulation of MAPK cascade
GO:0010629	0.765	negative regulation of gene expression
GO:0001817	0.754	regulation of cytokine production
GO:0007154	0.752	cell communication
GO:0031324	0.730	negative regulation of cellular metabolic process
GO:0065008	0.710	regulation of biological quality
GO:0046883	0.702	regulation of hormone secretion
GO:0048585	0.698	negative regulation of response to stimulus
GO:0009890	0.692	negative regulation of biosynthetic process
GO:0031326	0.687	regulation of cellular biosynthetic process
GO:0042592	0.686	homeostatic process
GO:0051222	0.685	positive regulation of protein transport
GO:1903532	0.683	positive regulation of secretion by cell
GO:0023052	0.657	signaling
GO:0051716	0.655	cellular response to stimulus
GO:0007165	0.654	signal transduction
GO:0023057	0.617	negative regulation of signaling
GO:0048878	0.607	chemical homeostasis
GO:1902532	0.576	negative regulation of intracellular signal transduction
GO:0051179	0.558	localization
GO:0050714	0.541	positive regulation of protein secretion
GO:0031327	0.540	negative regulation of cellular biosynthetic process
GO:0010677	0.385	negative regulation of cellular carbohydrate metabolic process
GO:0001819	0.368	positive regulation of cytokine production
GO:0008104	0.365	protein localization
GO:0032502	0.346	developmental process
GO:0046887	0.340	positive regulation of hormone secretion
GO:0080134	0.339	regulation of response to stress
GO:0010556	0.334	regulation of macromolecule biosynthetic process
GO:0055088	0.326	lipid homeostasis
GO:0019219	0.303	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0032991	0.993	protein-containing complex
GO:0005576	0.992	extracellular region
GO:0005615	0.948	extracellular space
GO:0043227	0.915	membrane-bounded organelle
GO:0016020	0.814	membrane
GO:0005622	0.749	intracellular anatomical structure
GO:0005737	0.561	cytoplasm
GO:0071944	0.313	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]