StarFunc result for job id Q9BXJ5

User Input

>input (285 residues)
MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRM
GFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKH
GTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHY
NASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILA
LKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D8U4	0.677	0.660	6.110E-40	294	0.944	0.915	Q9D8U4.pdb.gz	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
2	AFDB:Q8BVD7	0.480	0.473	4.101E-30	289	0.579	0.571	Q8BVD7.pdb.gz	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
3	AFDB:Q4ZJN1	0.462	0.396	5.146E-20	333	0.418	0.357	Q4ZJN1.pdb.gz	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
4	AFDB:Q8K479	0.495	0.576	7.413E-20	243	0.319	0.374	Q8K479.pdb.gz	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
5	AFDB:A0A0B5JQA2	0.478	0.555	2.103E-19	244	0.298	0.348	A0A0B5JQA2.pdb.gz
6	AFDB:B2RNN3	0.459	0.394	6.622E-19	333	0.425	0.363	B2RNN3.pdb.gz	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
7	AFDB:A8K660	0.479	0.557	1.005E-18	244	0.361	0.422	A8K660.pdb.gz	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
8	AFDB:Q4VAQ0	0.455	0.306	1.525E-18	427	0.386	0.258	Q4VAQ0.pdb.gz	Q4VAQ0_HUMAN COL8A2 protein OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=1
9	AFDB:Q60994	0.466	0.536	1.979E-18	247	0.347	0.401	Q60994.pdb.gz	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
10	AFDB:Q3Y5Z3	0.468	0.551	4.558E-18	240	0.333	0.396	Q3Y5Z3.pdb.gz	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
11	PDB:5kc6B	0.410	0.779	3.000E-11	144	0.112	0.222	5kc6B.pdb.gz
12	PDB:5h4bA	0.392	0.786	1.434E-10	136	0.123	0.257	5h4bA.pdb.gz
13	PDB:7e57B	0.307	0.668	9.372E-4	123	0.060	0.138	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:5a3oA	0.251	0.538	7.543E-3	114	0.042	0.105	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
15	PDB:6oj0A	0.243	0.353	1.928E-2	178	0.053	0.084	6oj0A.pdb.gz
16	PDB:7l2zF	0.200	0.101	2.031E-2	664	0.053	0.023	7l2zF.pdb.gz
17	PDB:5jovA	0.182	0.065	2.777E-2	949	0.063	0.019	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
18	PDB:3i26D	0.207	0.166	5.470E-2	369	0.042	0.033	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
19	PDB:1olmE	0.152	0.118	7.879E-2	397	0.039	0.028	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
20	PDB:5eiyB	0.177	0.089	8.745E-2	658	0.053	0.023	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXJ5	0.0	577	285	1.000	1.000	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
2	Q9D8U4	1.37e-173	483	294	0.944	0.915	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
3	Q8BVD7	2.98e-98	291	289	0.561	0.554	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
4	B2RNN3	4.57e-53	177	333	0.389	0.333	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
5	D3ZJ76	7.58e-53	177	331	0.379	0.326	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
6	P0C862	4.20e-52	175	333	0.386	0.330	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
7	Q4ZJN1	2.91e-51	173	333	0.375	0.321	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
8	A8K660	8.76e-43	148	244	0.312	0.365	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
9	Q15848	8.76e-43	148	244	0.312	0.365	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q3Y5Z3	3.30e-42	147	240	0.319	0.379	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
11	Q60994	2.01e-41	145	247	0.319	0.368	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
12	Q8K3R4	1.41e-40	142	244	0.323	0.377	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
13	Q4ZJM7	3.14e-39	145	482	0.358	0.212	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
14	A5PN28	1.16e-36	138	489	0.379	0.221	OTO1A_DANRE Otolin-1-A OS=Danio rerio OX=7955 GN=otol1a PE=1 SV=1
15	P83371	2.08e-36	137	508	0.389	0.219	OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta OX=8018 GN=otol1 PE=1 SV=1
16	P31720	2.10e-31	119	245	0.316	0.367	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
17	P98086	2.31e-31	119	245	0.323	0.376	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
18	Q8K479	4.31e-30	115	243	0.312	0.366	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
19	Q9Z1K4	4.44e-30	116	295	0.207	0.200	Q9Z1K4_RAT Collagen alpha 1 type X (Fragment) OS=Rattus norvegicus OX=10116 GN=Col10a1 PE=2 SV=1
20	A0A0G2K7A5	9.95e-30	120	680	0.207	0.087	A0A0G2K7A5_RAT Collagen type X alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col10a1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	3	19.1	BclA C-terminal domain
2	PF00386 C1q	1.4e-35	133.7	C1q domain
3	PF01391 Collagen	8.2e-14	62.4	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377547	0.753	Cyclin-J-like protein
2	9606.ENSP00000431284	0.700	Leupaxin
3	9606.ENSP00000457168	0.641	KICSTOR complex protein SZT2
4	9606.ENSP00000356599	0.616	Torsin-3A
5	9606.ENSP00000246006	0.581	Complement component C1q receptor
6	9606.ENSP00000386807	0.575	Neuropeptide-like protein C4orf48
7	9606.ENSP00000341785	0.573	Adiponectin receptor protein 1
8	9606.ENSP00000249442	0.572	Metaxin-2
9	9606.ENSP00000378408	0.536	Alanine aminotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.922	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.993	regulation of biological process
GO:0050794	0.899	regulation of cellular process
GO:0048583	0.858	regulation of response to stimulus
GO:0048518	0.838	positive regulation of biological process
GO:0010646	0.786	regulation of cell communication
GO:0009987	0.783	cellular process
GO:0023051	0.757	regulation of signaling
GO:0019222	0.737	regulation of metabolic process
GO:0048522	0.632	positive regulation of cellular process
GO:0060255	0.564	regulation of macromolecule metabolic process
GO:0051050	0.518	positive regulation of transport
GO:0006109	0.505	regulation of carbohydrate metabolic process
GO:0009966	0.479	regulation of signal transduction
GO:0031323	0.456	regulation of cellular metabolic process
GO:0009889	0.443	regulation of biosynthetic process
GO:0050896	0.432	response to stimulus
GO:0019216	0.398	regulation of lipid metabolic process
GO:0043255	0.384	regulation of carbohydrate biosynthetic process
GO:0010906	0.372	regulation of glucose metabolic process
GO:0010827	0.368	regulation of glucose transmembrane transport
GO:0019217	0.361	regulation of fatty acid metabolic process
GO:0048584	0.356	positive regulation of response to stimulus
GO:0062013	0.355	positive regulation of small molecule metabolic process
GO:0031326	0.353	regulation of cellular biosynthetic process
GO:0032881	0.348	regulation of polysaccharide metabolic process
GO:0010556	0.320	regulation of macromolecule biosynthetic process
GO:0031325	0.318	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.990	extracellular space
GO:0032991	0.941	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]