StarFunc result for job id Q9BXJ9

User Input

>input (866 residues)
MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDL
SLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQT
SPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL
EDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNF
LSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFN
PNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKH
AGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLN
EMQCMWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDFHTYCMRKITLRSYVD
LLKLEDVLRQHPFYFKAARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQR
RAQKKAQIEEEKKNAEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKF
LTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAV
CESKDLSDTVRTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQ
KRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMP
PGYEEDMKITVNGDSSAEAEELANEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXJ9	1.000	1.000	2.548E-94	866	1.000	1.000	Q9BXJ9.pdb.gz	NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
2	AFDB:A0A0R4I9S5	0.980	0.981	1.935E-83	865	0.841	0.842	A0A0R4I9S5.pdb.gz	A0A0R4I9S5_DANRE N(Alpha)-acetyltransferase 15, NatA auxiliary subunit b OS=Danio rerio OX=7955 GN=fi31d06 PE=1 SV=2
3	AFDB:F1QE25	0.976	0.975	7.677E-81	867	0.801	0.800	F1QE25.pdb.gz	F1QE25_DANRE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Danio rerio OX=7955 GN=narg1a PE=1 SV=1
4	PDB:6c95A	0.861	0.962	1.447E-76	773	0.893	1.000	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
5	AFDB:A4FU51	0.950	0.953	3.130E-74	864	0.702	0.704	A4FU51.pdb.gz	A4FU51_HUMAN NMDA receptor regulated 1-like OS=Homo sapiens OX=9606 GN=NARG1L PE=2 SV=1
6	AFDB:Q9VWI2	0.934	0.909	2.870E-61	890	0.524	0.510	Q9VWI2.pdb.gz	Q9VWI2_DROME N(Alpha)-acetyltransferase 15/16, isoform A OS=Drosophila melanogaster OX=7227 GN=Naa15-16 PE=1 SV=1
7	AFDB:F4HS68	0.861	0.820	8.352E-48	911	0.420	0.400	F4HS68.pdb.gz	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
8	AFDB:O74985	0.755	0.891	2.837E-37	729	0.315	0.374	O74985.pdb.gz	NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat1 PE=1 SV=1
9	PDB:4kvmB	0.746	0.887	4.617E-34	722	0.311	0.373	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
10	AFDB:P12945	0.750	0.760	6.467E-29	854	0.268	0.272	P12945.pdb.gz	NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT1 PE=1 SV=2
11	AFDB:Q38B37	0.657	0.786	6.789E-27	711	0.216	0.263	Q38B37.pdb.gz	Q38B37_TRYB2 N-acetyltransferase subunit Nat1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1320 PE=4 SV=1
12	PDB:4xnhA	0.741	0.812	7.902E-27	786	0.260	0.286	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
13	PDB:6hd7t	0.755	0.779	1.211E-25	838	0.277	0.286	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
14	PDB:4hnxA	0.648	0.780	5.645E-25	713	0.251	0.304	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
15	AFDB:Q9Y7X2	0.663	0.818	7.274E-22	695	0.200	0.249	Q9Y7X2.pdb.gz	YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC418.02 PE=3 SV=1
16	PDB:6vp9B	0.462	0.441	6.943E-10	914	0.121	0.115	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
17	PDB:7qdrB	0.170	0.135	8.931E-9	1212	0.136	0.097	7qdrB.pdb.gz
18	PDB:7dkhI	0.175	0.168	1.619E-8	914	0.132	0.125	7dkhI.pdb.gz
19	PDB:4bujB	0.240	0.166	1.736E-8	1367	0.111	0.070	4bujB.pdb.gz
20	PDB:6tedQ	0.223	0.218	3.620E-8	890	0.134	0.130	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1W3	0.0	1782	865	0.999	1.000	A0A0B4J1W3_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
2	A0A0R4I9S5	0.0	1489	865	0.842	0.843	A0A0R4I9S5_DANRE N(Alpha)-acetyltransferase 15, NatA auxiliary subunit b OS=Danio rerio OX=7955 GN=fi31d06 PE=1 SV=2
3	A4FU51	0.0	1285	864	0.706	0.707	A4FU51_HUMAN NMDA receptor regulated 1-like OS=Homo sapiens OX=9606 GN=NARG1L PE=2 SV=1
4	F1QE25	0.0	1428	867	0.803	0.802	F1QE25_DANRE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Danio rerio OX=7955 GN=narg1a PE=1 SV=1
5	F4HS68	0.0	622	911	0.430	0.408	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
6	Q6N069	0.0	1285	864	0.706	0.707	NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA16 PE=1 SV=2
7	Q80UM3	0.0	1751	865	0.980	0.982	NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus OX=10090 GN=Naa15 PE=1 SV=1
8	Q9BXJ9	0.0	1790	866	1.000	1.000	NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1
9	Q9VWI2	0.0	936	890	0.529	0.515	Q9VWI2_DROME N(Alpha)-acetyltransferase 15/16, isoform A OS=Drosophila melanogaster OX=7227 GN=Naa15-16 PE=1 SV=1
10	O74985	7.46e-151	462	729	0.314	0.373	NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat1 PE=1 SV=1
11	P12945	4.82e-94	317	854	0.267	0.270	NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT1 PE=1 SV=2
12	Q9NFL7	9.74e-74	258	711	0.200	0.243	Q9NFL7_9TRYP Putative N-acetyltransferase subunit NAT1 OS=Trypanosoma brucei OX=5691 GN=NAT1 PE=4 SV=1
13	Q38B37	1.21e-73	257	711	0.200	0.243	Q38B37_TRYB2 N-acetyltransferase subunit Nat1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1320 PE=4 SV=1
14	Q9Y7X2	8.98e-43	168	695	0.209	0.260	YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC418.02 PE=3 SV=1
15	O94474	0.017	41.6	1389	0.033	0.021	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
16	F4KEY9	0.11	38.5	1065	0.073	0.059	NAA25_ARATH N-terminal acetyltransferase B complex auxiliary subunit NAA25 OS=Arabidopsis thaliana OX=3702 GN=NAA25 PE=2 SV=1
17	Q5T764	0.12	38.1	474	0.033	0.061	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
18	E7EXH4	0.17	37.7	528	0.030	0.049	E7EXH4_DANRE Bardet-Biedl syndrome 4 OS=Danio rerio OX=7955 GN=zgc:152964 PE=4 SV=1
19	Q9VDQ7	0.24	37.7	948	0.068	0.062	NAA25_DROME Phagocyte signaling-impaired protein OS=Drosophila melanogaster OX=7227 GN=psidin PE=2 SV=1
20	Q726A1	0.33	36.2	207	0.037	0.155	Q726A1_DESVH TPR domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3272 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.0053	28.3	Anaphase-promoting complex, cyclosome, subunit 3
2	PF19529 DUF6057	59	14.0	Family of unknown function (DUF6057)
3	PF12569 NatA_aux_su	1.6e-218	738.5	N-terminal acetyltransferase A, auxiliary subunit
4	PF00515 TPR_1	0.098	23.7	Tetratricopeptide repeat
5	PF13414 TPR_11	0.095	23.7	TPR repeat
6	PF13424 TPR_12	3.5	19.3	Tetratricopeptide repeat
7	PF13428 TPR_14	2.5e-08	45.0	Tetratricopeptide repeat
8	PF13429 TPR_15	37	15.1	Tetratricopeptide repeat
9	PF13432 TPR_16	0.00016	33.5	Tetratricopeptide repeat
10	PF14559 TPR_19	1.2e-05	37.0	Tetratricopeptide repeat
11	PF07719 TPR_2	3.5e-09	47.1	Tetratricopeptide repeat
12	PF07720 TPR_3	8e+02	11.5	Tetratricopeptide repeat
13	PF13176 TPR_7	3.6e+02	12.6	Tetratricopeptide repeat
14	PF13181 TPR_8	0.004	28.3	Tetratricopeptide repeat
15	PF13371 TPR_9	1	20.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240922	0.999	N-alpha-acetyltransferase 50
2	9606.ENSP00000417763	0.999	N-alpha-acetyltransferase 10
3	9606.ENSP00000384474	0.998	Huntingtin-interacting protein K
4	9606.ENSP00000286794	0.996	N-alpha-acetyltransferase 11
5	9606.ENSP00000452521	0.990	N-alpha-acetyltransferase 30
6	9606.ENSP00000354972	0.985	N-alpha-acetyltransferase 35, NatC auxiliary subunit
7	9606.ENSP00000335636	0.976	N-alpha-acetyltransferase 20
8	9606.ENSP00000261745	0.972	N-alpha-acetyltransferase 25, NatB auxiliary subunit
9	9606.ENSP00000368716	0.961	N-alpha-acetyltransferase 16, NatA auxiliary subunit
10	9606.ENSP00000332103	0.901	N-alpha-acetyltransferase 38, NatC auxiliary subunit
11	9606.ENSP00000385903	0.900	N-alpha-acetyltransferase 60
12	9606.ENSP00000296577	0.876	ATP-binding cassette sub-family E member 1
13	9606.ENSP00000353741	0.834	Eukaryotic peptide chain release factor subunit 1
14	9606.ENSP00000386636	0.831	Lupus La protein
15	9606.ENSP00000261520	0.826	Little elongation complex subunit 2
16	9606.ENSP00000367024	0.824	N-alpha-acetyltransferase 40
17	9606.ENSP00000352257	0.760	X-ray repair cross-complementing protein 6
18	9606.ENSP00000348442	0.750	26S proteasome non-ATPase regulatory subunit 12
19	9606.ENSP00000375978	0.738	X-ray repair cross-complementing protein 5
20	9606.ENSP00000357047	0.735	Mediator of RNA polymerase II transcription subunit 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043022	1.000	ribosome binding
GO:0016407	1.000	acetyltransferase activity
GO:0003723	0.988	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0019538	0.980	protein metabolic process
GO:0010467	0.973	gene expression
GO:0065007	0.965	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0031365	0.953	N-terminal protein amino acid modification
GO:0043543	0.952	protein acylation
GO:0050794	0.933	regulation of cellular process
GO:0006473	0.927	protein acetylation
GO:0051604	0.703	protein maturation
GO:0031647	0.626	regulation of protein stability
GO:0019222	0.561	regulation of metabolic process
GO:0048519	0.501	negative regulation of biological process
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0080090	0.483	regulation of primary metabolic process
GO:0031323	0.482	regulation of cellular metabolic process
GO:0051171	0.474	regulation of nitrogen compound metabolic process
GO:0048523	0.452	negative regulation of cellular process
GO:0009987	0.430	cellular process
GO:0010468	0.425	regulation of gene expression
GO:0048518	0.409	positive regulation of biological process
GO:0031326	0.335	regulation of cellular biosynthetic process
GO:0010556	0.333	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.997	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0140535	0.916	intracellular protein-containing complex
GO:1902494	0.910	catalytic complex
GO:0016020	0.853	membrane
GO:1990234	0.746	transferase complex
GO:0031414	0.706	N-terminal protein acetyltransferase complex
GO:0005576	0.547	extracellular region
GO:0005615	0.505	extracellular space
GO:0031982	0.493	vesicle
GO:0016604	0.491	nuclear body
GO:0031415	0.467	NatA complex
GO:1903561	0.386	extracellular vesicle
GO:0012505	0.373	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]