StarFunc result for job id Q9BXK1

User Input

>input (252 residues)
MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPP
PPPAASGPGPGAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAP
SAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRT
HTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPA
PSPAPSPAPAGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXK1	1.000	1.000	8.588E-42	252	1.000	1.000	Q9BXK1.pdb.gz	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
2	AFDB:P58334	0.391	0.393	1.667E-31	251	0.877	0.880	P58334.pdb.gz	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
3	AFDB:Q19A41	0.361	0.281	2.142E-19	325	0.544	0.422	Q19A41.pdb.gz	KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus OX=10090 GN=Klf14 PE=2 SV=1
4	AFDB:A8E7A9	0.373	0.376	1.950E-15	250	0.377	0.380	A8E7A9.pdb.gz	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
5	AFDB:A0A024R260	0.357	0.368	3.644E-14	244	0.385	0.398	A0A024R260.pdb.gz
6	AFDB:Q8TDD2	0.339	0.209	4.569E-13	431	0.381	0.223	Q8TDD2.pdb.gz	SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens OX=9606 GN=SP7 PE=1 SV=1
7	AFDB:F1R7F0	0.334	0.299	8.538E-12	283	0.258	0.230	F1R7F0.pdb.gz	F1R7F0_DANRE Krueppel-like factor 6 OS=Danio rerio OX=7955 GN=cb538 PE=4 SV=1
8	AFDB:A0A024R3X8	0.335	0.283	9.126E-12	302	0.262	0.219	A0A024R3X8.pdb.gz
9	AFDB:Q5FVT6	0.340	0.209	1.191E-11	415	0.333	0.202	Q5FVT6.pdb.gz	Q5FVT6_RAT Klf15 protein OS=Rattus norvegicus OX=10116 GN=Klf15 PE=2 SV=1
10	AFDB:Q90XE6	0.326	0.228	1.360E-11	365	0.274	0.189	Q90XE6.pdb.gz	KLF1_DANRE Kruppel-like factor 1 OS=Danio rerio OX=7955 GN=klf1 PE=2 SV=1
11	PDB:3w5kB	0.114	0.215	7.836E-3	110	0.115	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7r7jB	0.060	0.029	2.925	574	0.032	0.014	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
13	PDB:5c8dE	0.072	0.066	4.080	280	0.020	0.018	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
14	PDB:7oniH	0.087	0.067	4.361	380	0.052	0.034	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:3haxC	0.054	0.240	4.981	53	0.044	0.208	3haxC.pdb.gz	Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
16	PDB:7od1A	0.073	0.058	4.981	430	0.048	0.028	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:6htsR	0.090	0.278	5.324	72	0.044	0.153	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
18	PDB:7o4iW	0.070	0.059	5.690	312	0.060	0.048	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:3c95A	0.094	0.068	7.936	446	0.036	0.020	3c95A.pdb.gz
20	PDB:6gym6	0.087	0.069	8.482	335	0.083	0.063	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXK1	8.13e-173	478	252	1.000	1.000	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
2	P58334	1.74e-113	327	251	0.877	0.880	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
3	Q19A41	8.60e-63	201	325	0.540	0.418	KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus OX=10090 GN=Klf14 PE=2 SV=1
4	Q8TD94	6.21e-56	183	323	0.349	0.272	KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens OX=9606 GN=KLF14 PE=2 SV=2
5	A8E7A9	5.33e-49	163	250	0.409	0.412	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
6	Q13886	8.40e-49	162	244	0.425	0.439	KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens OX=9606 GN=KLF9 PE=1 SV=1
7	Q01713	8.96e-49	162	244	0.413	0.426	KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus OX=10116 GN=Klf9 PE=2 SV=1
8	O35739	1.38e-48	162	244	0.413	0.426	KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus OX=10090 GN=Klf9 PE=2 SV=1
9	A2BGS7	1.50e-45	153	216	0.310	0.361	A2BGS7_DANRE Krueppel-like factor 9 OS=Danio rerio OX=7955 GN=si:dkey-201c13.3 PE=2 SV=1
10	O08876	4.03e-43	154	480	0.254	0.133	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
11	O89091	7.04e-43	153	479	0.254	0.134	KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus OX=10090 GN=Klf10 PE=1 SV=1
12	Q95R58	7.60e-43	150	347	0.278	0.202	Q95R58_DROME SD05726p OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
13	Q8IPV7	8.10e-43	150	347	0.278	0.202	Q8IPV7_DROME Cabut, isoform B OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
14	Q8K1S5	1.18e-42	153	502	0.246	0.124	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
15	Q309C9	1.33e-42	153	501	0.246	0.124	Q309C9_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=2 SV=1
16	E9PTS6	1.36e-42	153	501	0.246	0.124	E9PTS6_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=4 SV=1
17	Q9VPQ5	1.39e-42	151	428	0.278	0.164	Q9VPQ5_DROME Cabut, isoform A OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=2
18	Q4R0P9	1.51e-42	151	428	0.278	0.164	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
19	O14901	2.42e-42	152	512	0.246	0.121	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
20	Q53QU8	2.42e-42	152	512	0.246	0.121	Q53QU8_HUMAN Uncharacterized protein TIEG2 OS=Homo sapiens OX=9606 GN=TIEG2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19126 DUF5810	5.3e+02	12.2	Family of unknown function (DUF5810)
2	PF16159 FOXP-CC	3.9	19.3	FOXP coiled-coil domain
3	PF00096 zf-C2H2	1.2e-11	55.5	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	0.00042	31.9	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.3e+02	14.0	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	75	15.1	C2H2-type zinc ribbon
7	PF12171 zf-C2H2_jaz	7e+02	11.9	Zinc-finger double-stranded RNA-binding
8	PF13913 zf-C2HC_2	8.1e+02	11.3	zinc-finger of a C2HC-type
9	PF05605 zf-Di19	3.2e+02	13.1	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	4.8e-10	50.6	Zinc-finger double domain
11	PF12874 zf-met	8.3	18.2	Zinc-finger of C2H2 type
12	PF02176 zf-TRAF	1.9e+02	14.2	TRAF-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250916

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378402	0.833	Paired amphipathic helix protein Sin3a
2	9606.ENSP00000406047	0.606	Testis-specific gene 13 protein
3	9606.ENSP00000239614	0.602	Myb/SANT-like DNA-binding domain-containing protein 2
4	9606.ENSP00000300179	0.510	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.933	transcription regulator activity
GO:0003700	0.915	DNA-binding transcription factor activity
GO:0000976	0.908	transcription cis-regulatory region binding
GO:0000981	0.762	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.698	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.630	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.313	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0006357	0.975	regulation of transcription by RNA polymerase II
GO:0009987	0.965	cellular process
GO:0048523	0.908	negative regulation of cellular process
GO:0009892	0.823	negative regulation of metabolic process
GO:0050896	0.770	response to stimulus
GO:0048518	0.656	positive regulation of biological process
GO:0009890	0.643	negative regulation of biosynthetic process
GO:0010605	0.623	negative regulation of macromolecule metabolic process
GO:0051716	0.618	cellular response to stimulus
GO:0048522	0.609	positive regulation of cellular process
GO:0051172	0.603	negative regulation of nitrogen compound metabolic process
GO:0031324	0.589	negative regulation of cellular metabolic process
GO:0045934	0.550	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.489	negative regulation of macromolecule biosynthetic process
GO:0031327	0.480	negative regulation of cellular biosynthetic process
GO:0051173	0.446	positive regulation of nitrogen compound metabolic process
GO:0010604	0.445	positive regulation of macromolecule metabolic process
GO:0045935	0.429	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.399	positive regulation of cellular biosynthetic process
GO:0010557	0.398	positive regulation of macromolecule biosynthetic process
GO:0045892	0.395	negative regulation of DNA-templated transcription
GO:0045893	0.389	positive regulation of DNA-templated transcription
GO:0045944	0.380	positive regulation of transcription by RNA polymerase II
GO:0000122	0.369	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.896	protein-containing complex
GO:0005694	0.355	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]