StarFunc result for job id Q9BXK5

User Input

>input (485 residues)
MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK
TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH
KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ
FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES
PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN
NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP
DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL
ALRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXK5	0.999	0.999	2.229E-52	485	1.000	1.000	Q9BXK5.pdb.gz	B2L13_HUMAN Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1
2	AFDB:Q642H1	0.072	0.063	5.538E-3	632	0.155	0.119	Q642H1.pdb.gz
3	PDB:1lxlA	0.247	0.506	1.875E-2	221	0.064	0.140	1lxlA.pdb.gz
4	AFDB:Q7K126	0.085	0.058	2.118E-2	844	0.153	0.088	Q7K126.pdb.gz	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
5	AFDB:A0A0B4KFZ2	0.103	0.051	3.864E-2	1161	0.144	0.060	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
6	AFDB:F4JWJ7	0.091	0.060	3.864E-2	845	0.142	0.082	F4JWJ7.pdb.gz	F4JWJ7_ARATH Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=NOT3 PE=1 SV=1
7	AFDB:Q8SSQ0	0.114	0.046	5.341E-2	1721	0.130	0.037	Q8SSQ0.pdb.gz	GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum OX=44689 GN=gefR PE=1 SV=1
8	AFDB:Q9VHC4	0.097	0.050	8.099E-2	1133	0.134	0.057	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
9	AFDB:Q9H3S7	0.107	0.036	8.482E-2	1636	0.169	0.050	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
10	AFDB:Q9TXS0	0.073	0.042	9.304E-2	968	0.155	0.077	Q9TXS0.pdb.gz	Q9TXS0_CAEEL FCH domain only protein 2 OS=Caenorhabditis elegans OX=6239 GN=fcho-1 PE=1 SV=1
11	AFDB:S4R418	0.103	0.096	9.744E-2	531	0.144	0.132	S4R418.pdb.gz	S4R418_HUMAN Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2 PE=1 SV=3
12	PDB:1o0lA	0.151	0.358	1.087E-1	188	0.064	0.165	1o0lA.pdb.gz
13	PDB:7cclC	0.179	0.484	1.727E-1	147	0.052	0.170	7cclC.pdb.gz
14	PDB:2k7wA	0.184	0.414	1.809E-1	192	0.041	0.104	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
15	PDB:4eukB	0.101	0.226	9.128E-1	152	0.043	0.138	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
16	PDB:1wn0C	0.098	0.249	1.098	138	0.041	0.145	1wn0C.pdb.gz
17	PDB:1yviA	0.097	0.224	1.150	140	0.039	0.136	1yviA.pdb.gz
18	PDB:4xgsB	0.129	0.295	1.590	164	0.058	0.171	4xgsB.pdb.gz	Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria
19	PDB:6n3qF	0.083	0.167	2.198	190	0.060	0.153	6n3qF.pdb.gz
20	PDB:5w62A	0.146	0.379	2.302	156	0.041	0.128	5w62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59017	0.0	562	434	0.687	0.767	B2L13_MOUSE Bcl-2-like protein 13 OS=Mus musculus OX=10090 GN=Bcl2l13 PE=1 SV=2
2	Q9BXK5	0.0	959	485	1.000	1.000	B2L13_HUMAN Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1
3	Q9CPT0	3.84e-04	45.1	328	0.064	0.095	B2L14_MOUSE Apoptosis facilitator Bcl-2-like protein 14 OS=Mus musculus OX=10090 GN=Bcl2l14 PE=1 SV=1
4	P34926	3.96e-04	45.8	2774	0.126	0.022	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1
5	Q9BZR8	0.002	42.4	327	0.066	0.098	B2L14_HUMAN Apoptosis facilitator Bcl-2-like protein 14 OS=Homo sapiens OX=9606 GN=BCL2L14 PE=1 SV=1
6	K7EMX4	0.003	42.0	360	0.066	0.089	K7EMX4_HUMAN Apoptosis facilitator Bcl-2-like protein 14 OS=Homo sapiens OX=9606 GN=BCL2L14 PE=1 SV=1
7	F7EQF3	0.029	38.5	208	0.087	0.202	F7EQF3_RAT BCL2-antagonist/killer 1 OS=Rattus norvegicus OX=10116 GN=Bak1 PE=3 SV=1
8	O08734	0.18	35.8	209	0.078	0.182	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
9	O35843	0.53	34.7	235	0.049	0.102	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
10	M9PB32	0.79	35.0	19560	0.101	0.003	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PBZ0	0.94	34.7	22830	0.101	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC41	0.94	34.7	22743	0.101	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PB30	0.95	34.7	22949	0.101	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
14	M9PBZ4	1.0	34.7	18014	0.101	0.003	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PC45	1.0	34.7	22300	0.101	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PEH5	1.2	34.3	20710	0.101	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PEI1	1.2	34.3	21657	0.101	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	Q07817	1.3	33.5	233	0.052	0.107	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
19	Q9U0G6	1.3	34.3	2209	0.062	0.014	Q9U0G6_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0412400 PE=4 SV=1
20	M9NER8	1.5	34.3	15638	0.101	0.003	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	1.6e-07	43.2	Apoptosis regulator proteins, Bcl-2 family
2	PF15677 CEND1	13	17.8	Cell cycle exit and neuronal differentiation protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000059754

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000014277	0.852	GABA(A) receptor-associated protein-like 2
2	9598.ENSPTRP00000014784	0.839	GABA(A) receptor-associated protein
3	9598.ENSPTRP00000060094	0.839	GABA(A) receptor-associated protein like 1
4	9598.ENSPTRP00000026048	0.765	Uncharacterized protein
5	9598.ENSPTRP00000053207	0.678	Family with sequence similarity 57, member A
6	9598.ENSPTRP00000061020	0.668	Transmembrane protein 188
7	9598.ENSPTRP00000044863	0.613	Hydroxysteroid (17-beta) dehydrogenase 11
8	9598.ENSPTRP00000035291	0.591	Ly-6/neurotoxin-like protein 1
9	9598.ENSPTRP00000048365	0.590	Programmed cell death 6
10	9598.ENSPTRP00000047873	0.582	Choline kinase alpha
11	9598.ENSPTRP00000047438	0.577	FUN14 domain containing 1
12	9598.ENSPTRP00000044946	0.567	Human immunodeficiency virus type I enhancer binding protein 2
13	9598.ENSPTRP00000006709	0.559	K(lysine) acetyltransferase 5
14	9598.ENSPTRP00000005394	0.551	BCL2/adenovirus E1B 19kDa interacting protein 3
15	9598.ENSPTRP00000018081	0.543	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
16	9598.ENSPTRP00000060075	0.541	EGF containing fibulin-like extracellular matrix protein 1
17	9598.ENSPTRP00000022903	0.532	BCL2-like 1
18	9598.ENSPTRP00000048301	0.505	IQ motif containing GTPase activating protein 2
19	9598.ENSPTRP00000039897	0.504	Myosin IB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.383	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0071840	0.886	cellular component organization or biogenesis
GO:0006996	0.865	organelle organization
GO:0050896	0.753	response to stimulus
GO:0019222	0.748	regulation of metabolic process
GO:0007005	0.709	mitochondrion organization
GO:0048519	0.645	negative regulation of biological process
GO:0048523	0.622	negative regulation of cellular process
GO:0008152	0.604	metabolic process
GO:0048518	0.574	positive regulation of biological process
GO:0051716	0.571	cellular response to stimulus
GO:0012501	0.570	programmed cell death
GO:0006915	0.551	apoptotic process
GO:0042981	0.526	regulation of apoptotic process
GO:0048522	0.520	positive regulation of cellular process
GO:0031323	0.512	regulation of cellular metabolic process
GO:0044237	0.455	cellular metabolic process
GO:0051179	0.448	localization
GO:0006950	0.440	response to stress
GO:0060255	0.436	regulation of macromolecule metabolic process
GO:0080090	0.388	regulation of primary metabolic process
GO:0051171	0.388	regulation of nitrogen compound metabolic process
GO:0007154	0.382	cell communication
GO:0006810	0.335	transport
GO:0023052	0.314	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005622	0.978	intracellular anatomical structure
GO:0043227	0.975	membrane-bounded organelle
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005737	0.936	cytoplasm
GO:0005634	0.588	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]