StarFunc result for job id Q9BXL6

User Input

>input (1004 residues)
MGELCRRDSALTALDEETLWEMMESHRHRIVRCICPSRLTPYLRQAKVLCQLDEEEVLHS
PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME
TSKLTECLAGAIGSLQEELNQEKGQKEVLLRRCQQLQEHLGLAETRAEGLHQLEADHSRM
KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQRANMVS
SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGSRQE
LVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKE
RDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQEART
REPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPAPPS
QQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLESSL
QPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHRVTP
GSAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEEAVGLLRRVDGFCCLSVKVNTDG
YKRLLQDLEAKVATSGDSFYIRVNLAMEGRAKGELQVHCNEVLHVTDTMFQGCGCWHAHR
VNSYTMKDTAAHGTIPNYSRAQQQLIALIQDMTQQCTVTRKPSSGGPQKLVRIVSMDKAK
ASPLRLSFDRGQLDPSRMEGSSTCFWAESCLTLVPYTLVRPHRPARPRPVLLVPRAVGKI
LSEKLCLLQGFKKCLAEYLSQEEYEAWSQRGDIIQEGEVSGGRCWVTRHAVESLMEKNTH
ALLDVQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDL
DRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C1N2	0.487	0.482	0.000	1013	1.000	0.991	A0A494C1N2.pdb.gz	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
2	AFDB:Q8CIS0	0.382	0.332	9.465E-63	1159	0.326	0.282	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
3	AFDB:Q5F3W0	0.394	0.341	2.275E-62	1170	0.323	0.277	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
4	AFDB:Q9BWT7	0.239	0.233	3.338E-46	1032	0.298	0.290	Q9BWT7.pdb.gz	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
5	AFDB:P39447	0.267	0.164	9.988E-24	1745	0.122	0.070	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
6	AFDB:A0A2R8QMK9	0.269	0.170	2.830E-22	1689	0.119	0.070	A0A2R8QMK9.pdb.gz
7	AFDB:Q62696	0.235	0.257	1.825E-21	911	0.100	0.110	Q62696.pdb.gz	DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1
8	AFDB:Q9Z0U1	0.269	0.236	3.932E-21	1167	0.118	0.101	Q9Z0U1.pdb.gz	ZO2_MOUSE Tight junction protein ZO-2 OS=Mus musculus OX=10090 GN=Tjp2 PE=1 SV=2
9	AFDB:Q95168	0.258	0.225	2.401E-20	1174	0.121	0.103	Q95168.pdb.gz	ZO2_CANLF Tight junction protein ZO-2 OS=Canis lupus familiaris OX=9615 GN=TJP2 PE=1 SV=1
10	PDB:2xkxA	0.225	0.300	1.300E-17	721	0.086	0.119	2xkxA.pdb.gz
11	AFDB:Q9H257	0.135	0.246	3.722E-15	536	0.142	0.267	Q9H257.pdb.gz	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
12	PDB:6nuiA	0.142	0.582	7.936E-7	198	0.043	0.217	6nuiA.pdb.gz
13	PDB:4f4jA	0.137	0.594	2.249E-6	189	0.031	0.164	4f4jA.pdb.gz
14	PDB:7mixC	0.129	0.279	2.376E-6	324	0.055	0.170	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
15	PDB:1lvgA	0.136	0.562	8.382E-6	190	0.044	0.232	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
16	PDB:2anbA	0.137	0.528	2.800E-5	206	0.034	0.165	2anbA.pdb.gz	Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
17	PDB:7p70A	0.078	0.187	3.301E-4	407	0.031	0.076	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:1z6gA	0.132	0.531	3.683E-4	191	0.021	0.110	1z6gA.pdb.gz
19	PDB:7pc3A	0.082	0.197	9.353E-4	405	0.026	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7qqmA	0.086	0.201	5.117E-3	413	0.023	0.056	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1N2	0.0	2043	1013	1.000	0.991	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
2	Q9BXL6	0.0	2051	1004	1.000	1.000	CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=2
3	Q9BXL7	8.96e-131	426	1154	0.348	0.302	CAR11_HUMAN Caspase recruitment domain-containing protein 11 OS=Homo sapiens OX=9606 GN=CARD11 PE=1 SV=3
4	Q8CIS0	2.43e-130	425	1159	0.355	0.307	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
5	P58660	9.09e-78	277	1021	0.310	0.305	CAR10_MOUSE Caspase recruitment domain-containing protein 10 OS=Mus musculus OX=10090 GN=Card10 PE=1 SV=1
6	Q17RA1	1.00e-76	274	1030	0.309	0.301	Q17RA1_HUMAN Caspase recruitment domain family, member 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=1
7	Q9BWT7	1.90e-76	273	1032	0.309	0.300	CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens OX=9606 GN=CARD10 PE=1 SV=2
8	Q5F3W0	2.18e-59	224	1170	0.148	0.127	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
9	Q9EPY0	1.57e-37	150	536	0.134	0.252	CARD9_RAT Caspase recruitment domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Card9 PE=1 SV=1
10	A2AIV8	1.69e-36	147	536	0.133	0.250	CARD9_MOUSE Caspase recruitment domain-containing protein 9 OS=Mus musculus OX=10090 GN=Card9 PE=1 SV=1
11	Q9H257	4.65e-36	146	536	0.133	0.250	CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CARD9 PE=1 SV=2
12	A8JQV8	4.08e-17	89.4	1446	0.105	0.073	A8JQV8_DROME Polychaetoid, isoform K OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
13	Q7K4E2	4.59e-17	89.0	974	0.105	0.108	Q7K4E2_DROME LD43161p OS=Drosophila melanogaster OX=7227 GN=pyd PE=2 SV=1
14	Q8MQQ3	5.21e-17	89.0	1149	0.105	0.091	Q8MQQ3_DROME LP05923p OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
15	A0A0B4K6C7	6.33e-17	89.0	1285	0.105	0.082	A0A0B4K6C7_DROME Polychaetoid, isoform L OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
16	A0A0B4K6Y7	7.41e-17	89.0	2395	0.105	0.044	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
17	Q9VHK1	1.16e-16	88.2	1735	0.105	0.061	Q9VHK1_DROME Polychaetoid, isoform J OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=4
18	Q9VHK3	1.21e-16	88.2	2090	0.105	0.050	Q9VHK3_DROME Polychaetoid, isoform A OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=3
19	B7Z0U1	4.08e-16	86.3	1386	0.105	0.076	B7Z0U1_DROME Polychaetoid, isoform I OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
20	A8JQV7	4.27e-16	86.3	1301	0.105	0.081	A8JQV7_DROME Polychaetoid, isoform G OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	2.1e-21	87.1	Caspase recruitment domain
2	PF00625 Guanylate_kin	0.058	24.6	Guanylate kinase
3	PF00595 PDZ	15	17.3	PDZ domain
4	PF00102 Y_phosphatase	3.1e+02	12.3	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458715

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359612	0.986	B-cell lymphoma/leukemia 10
2	9606.ENSP00000384570	0.857	Caspase recruitment domain-containing protein 10
3	9606.ENSP00000263125	0.856	Protein kinase C theta type
4	9606.ENSP00000305355	0.837	Protein kinase C beta type
5	9606.ENSP00000380150	0.833	Caspase recruitment domain-containing protein 11
6	9606.ENSP00000319279	0.830	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
7	9606.ENSP00000241051	0.750	DEP domain containing 7
8	9606.ENSP00000376896	0.739	Interleukin-36 receptor antagonist protein
9	9606.ENSP00000350467	0.715	GCN5 related N-acetyltransferases
10	9606.ENSP00000379891	0.688	AP-1 complex subunit sigma-3
11	9606.ENSP00000354080	0.630	Signal peptide, CUB and EGF-like domain-containing protein 1
12	9606.ENSP00000298912	0.627	Calmin
13	9606.ENSP00000322276	0.611	Vascular non-inflammatory molecule 2
14	9606.ENSP00000220751	0.610	Receptor-interacting serine/threonine-protein kinase 2
15	9606.ENSP00000264257	0.610	Interleukin-1 receptor-like 2
16	9606.ENSP00000357750	0.595	Adapter protein CIKS
17	9606.ENSP00000389709	0.562	Probable E3 SUMO-protein ligase RNF212
18	9606.ENSP00000333539	0.540	Mirror-image polydactyly 1
19	9606.ENSP00000399136	0.539	Sodium- and chloride-dependent betaine transporter
20	9606.ENSP00000307272	0.520	Regulatory-associated protein of mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.996	protein domain specific binding
GO:0019899	0.480	enzyme binding
GO:0019900	0.404	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.988	response to stimulus
GO:0070887	0.980	cellular response to chemical stimulus
GO:0051092	0.980	positive regulation of NF-kappaB transcription factor activity
GO:0009893	0.979	positive regulation of metabolic process
GO:0051246	0.962	regulation of protein metabolic process
GO:0019221	0.955	cytokine-mediated signaling pathway
GO:0048522	0.954	positive regulation of cellular process
GO:0048523	0.952	negative regulation of cellular process
GO:0010604	0.944	positive regulation of macromolecule metabolic process
GO:0031399	0.832	regulation of protein modification process
GO:0051173	0.819	positive regulation of nitrogen compound metabolic process
GO:0051247	0.726	positive regulation of protein metabolic process
GO:0042325	0.686	regulation of phosphorylation
GO:0042981	0.672	regulation of apoptotic process
GO:0031325	0.668	positive regulation of cellular metabolic process
GO:0071356	0.519	cellular response to tumor necrosis factor
GO:0001932	0.518	regulation of protein phosphorylation
GO:0031401	0.511	positive regulation of protein modification process
GO:0048583	0.433	regulation of response to stimulus
GO:0023051	0.411	regulation of signaling
GO:0010646	0.411	regulation of cell communication
GO:0042327	0.394	positive regulation of phosphorylation
GO:0060548	0.389	negative regulation of cell death
GO:0043069	0.382	negative regulation of programmed cell death
GO:0001934	0.367	positive regulation of protein phosphorylation
GO:0009966	0.355	regulation of signal transduction
GO:0051239	0.335	regulation of multicellular organismal process
GO:0033209	0.331	tumor necrosis factor-mediated signaling pathway
GO:0043066	0.313	negative regulation of apoptotic process
GO:0002682	0.304	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016234	0.996	inclusion body
GO:0016235	0.994	aggresome
GO:0043231	0.422	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]