StarFunc result for job id Q9BXM0

User Input

>input (1461 residues)
MEARSRSAEELRRAELVEIIVETEAQTGVSGINVAGGGKEGIFVRELREDSPAARSLSLQ
EGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEIKGP
RAKVAKLNIQSLSPVKKKKMVPGALGVPADLAPVDVEFSFPKFSRLRRGLKAEAVKGPVP
AAPARRRLQLPRLRVREVAEEAQAARLAAAAPPPRKAKVEAEVAAGARFTAPQVELVGPR
LPGAEVGVPQVSAPKAAPSAEAAGGFALHLPTLGLGAPAPPAVEAPAVGIQVPQVELPAL
PSLPTLPTLPCLETREGAVSVVVPTLDVAAPTVGVDLALPGAEVEARGEAPEVALKMPRL
SFPRFGARAKEVAEAKVAKVSPEARVKGPRLRMPTFGLSLLEPRPAAPEVVESKLKLPTI
KMPSLGIGVSGPEVKVPKGPEVKLPKAPEVKLPKVPEAALPEVRLPEVELPKVSEMKLPK
VPEMAVPEVRLPEVELPKVSEMKLPKVPEMAVPEVRLPEVQLLKVSEMKLPKVPEMAVPE
VRLPEVQLPKVSEMKLPEVSEVAVPEVRLPEVQLPKVPEMKVPEMKLPKVPEMKLPEMKL
PEVQLPKVPEMAVPDVHLPEVQLPKVPEMKLPEMKLPEVKLPKVPEMAVPDVHLPEVQLP
KVPEMKLPKMPEMAVPEVRLPEVQLPKVSEMKLPKVPEMAVPDVHLPEVQLPKVCEMKVP
DMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAP
EVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPE
VDGEAHVGVPSLTLPSVELDLPGALGLQGQVPAAKMGKGERVEGPEVAAGVREVGFRVPS
VEIVTPQLPAVEIEEGRLEMIETKVKPSSKFSLPKFGLSGPKVAKAEAEGAGRATKLKVS
KFAISLPKARVGAEAEAKGAGEAGLLPALDLSIPQLSLDAHLPSGKVEVAGADLKFKGPR
FALPKFGVRGRDTEAAELVPGVAELEGKGWGWDGRVKMPKLKMPSFGLARGKEAEVQGDR
ASPGEKAESTAVQLKIPEVELVTLGAQEEGRAEGAVAVSGMQLSGLKVSTAGQVVTEGHD
AGLRMPPLGISLPQVELTGFGEAGTPGQQAQSTVPSAEGTAGYRVQVPQVTLSLPGAQVA
GGELLVGEGVFKMPTVTVPQLELDVGLSREAQAGEAATGEGGLRLKLPTLGARARVGGEG
AEEQPPGAERTFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHKLKVRLPRFGLVRAKEGA
EEGEKAKSPKLRLPRVGFSQSEMVTGEGSPSPEEEEEEEEEGSGEGASGRRGRVRVRLPR
VGLAAPSKASRGQEGDAAPKSPVREKSPKFRFPRVSLSPKARSGSGDQEEGGLRVRLPSV
GFSETGAPGPARMEGAQAAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55103	0.126	0.132	0.000	1391	0.776	0.815	O55103.pdb.gz	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
2	AFDB:Q9BXM0	0.999	0.999	0.000	1461	1.000	1.000	Q9BXM0.pdb.gz	PRAX_HUMAN Periaxin OS=Homo sapiens OX=9606 GN=PRX PE=1 SV=2
3	AFDB:B4DTV0	0.057	0.074	1.888E-14	1079	0.198	0.268	B4DTV0.pdb.gz	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:A0JLR7	0.031	0.037	1.994E-10	1069	0.180	0.246	A0JLR7.pdb.gz	A0JLR7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
5	AFDB:Q8VDN3	0.031	0.042	2.648E-7	1024	0.170	0.242	Q8VDN3.pdb.gz	Q8VDN3_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
6	AFDB:Q7KNQ9	0.054	0.052	2.246E-6	1557	0.139	0.130	Q7KNQ9.pdb.gz	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
7	AFDB:Q6DFV3	0.038	0.030	4.887E-6	1944	0.182	0.137	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
8	AFDB:Q5T5U3	0.037	0.034	1.673E-5	1958	0.162	0.121	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
9	AFDB:Q9QXN0	0.048	0.036	1.786E-5	1986	0.164	0.120	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
10	PDB:7p73A	0.048	0.157	2.146E-5	420	0.019	0.067	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	AFDB:F1RCC9	0.048	0.056	4.145E-5	1179	0.133	0.165	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
12	PDB:7pc3A	0.045	0.149	1.707E-4	405	0.017	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7qqmA	0.038	0.117	2.517E-4	413	0.020	0.070	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:2xkxA	0.045	0.087	1.117E-3	721	0.016	0.033	2xkxA.pdb.gz
15	PDB:7pe9I	0.043	0.172	7.312E-3	317	0.010	0.044	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:5n7dA	0.045	0.140	7.802E-3	423	0.014	0.047	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
17	PDB:2l4tA	0.045	0.371	1.011E-2	124	0.015	0.177	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
18	PDB:7p70A	0.041	0.129	1.398E-2	407	0.014	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:7qqnC	0.041	0.129	1.591E-2	414	0.013	0.046	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.032	0.101	1.698E-2	415	0.010	0.036	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55103	0.0	1745	1391	0.727	0.763	PRAX_MOUSE Periaxin OS=Mus musculus OX=10090 GN=Prx PE=1 SV=1
2	Q63425	0.0	1832	1383	0.741	0.783	PRAX_RAT Periaxin OS=Rattus norvegicus OX=10116 GN=Prx PE=1 SV=2
3	Q9BXM0	0.0	2757	1461	1.000	1.000	PRAX_HUMAN Periaxin OS=Homo sapiens OX=9606 GN=PRX PE=1 SV=2
4	Q09666	1.64e-51	203	5890	0.288	0.071	AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2
5	E9Q616	1.44e-49	197	5656	0.242	0.063	E9Q616_MOUSE AHNAK nucleoprotein (desmoyokin) OS=Mus musculus OX=10090 GN=Ahnak PE=1 SV=1
6	A0JLR7	1.39e-45	182	1069	0.206	0.282	A0JLR7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
7	Q61484	4.09e-44	178	1231	0.219	0.260	Q61484_MOUSE Desmoyokin (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
8	B4DTV0	4.43e-37	155	1079	0.208	0.282	B4DTV0_HUMAN cDNA FLJ57801, highly similar to Homo sapiens AHNAK nucleoprotein (desmoyokin) (AHNAK), transcript variant 1, mRNA (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
9	A0PJF4	2.17e-36	153	1564	0.201	0.187	A0PJF4_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
10	Q8IVF2	5.22e-29	129	5795	0.217	0.055	AHNK2_HUMAN Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2
11	Q9LXB8	1.01e-27	119	370	0.093	0.368	PLPK1_ARATH Protein PELPK1 OS=Arabidopsis thaliana OX=3702 GN=PELPK1 PE=2 SV=1
12	A0A7N9VR94	1.02e-22	108	3501	0.031	0.013	A0A7N9VR94_MOUSE AHNAK nucleoprotein 2 OS=Mus musculus OX=10090 GN=Ahnak2 PE=1 SV=1
13	Q8BKS2	9.61e-19	95.1	939	0.175	0.272	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
14	Q8BRB8	2.78e-15	83.2	520	0.088	0.248	Q8BRB8_MOUSE PDZ domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
15	Q8VDN3	3.45e-15	83.6	1024	0.168	0.240	Q8VDN3_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
16	M9PCJ6	3.63e-11	71.2	18641	0.114	0.009	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PC48	3.82e-11	70.9	18095	0.114	0.009	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC41	2.37e-09	65.1	22743	0.113	0.007	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEI1	2.41e-09	65.1	21657	0.113	0.008	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PB30	2.45e-09	65.1	22949	0.113	0.007	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02389 Cornifin	4.3e-10	51.3	Cornifin (SPRR) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326018

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378635	0.978	Dystrophin-related protein 2
2	9606.ENSP00000242480	0.966	E3 SUMO-protein ligase EGR2
3	9606.ENSP00000356042	0.951	Ezrin
4	9606.ENSP00000380093	0.951	Transcription factor SOX-10
5	9606.ENSP00000340510	0.945	Periplakin
6	9606.ENSP00000442600	0.868	Dystroglycan
7	9606.ENSP00000356515	0.842	Utrophin
8	9606.ENSP00000432943	0.811	Myelin protein P0
9	9606.ENSP00000256103	0.769	Myelin P2 protein
10	9606.ENSP00000363134	0.731	Gap junction beta-1 protein
11	9606.ENSP00000220822	0.720	Ganglioside-induced differentiation-associated protein 1
12	9606.ENSP00000400365	0.706	Laminin subunit alpha-2
13	9606.ENSP00000484631	0.660	Peripheral myelin protein 22
14	9606.ENSP00000258341	0.637	Laminin subunit gamma-1
15	9606.ENSP00000222399	0.609	Laminin subunit beta-1
16	9606.ENSP00000345752	0.607	Myotubularin-related protein 2
17	9606.ENSP00000376048	0.604	Myelin-associated glycoprotein
18	9606.ENSP00000256190	0.602	Myotubularin-related protein 13
19	9606.ENSP00000318057	0.573	Early growth response protein 3
20	9606.ENSP00000380958	0.572	Myelin basic protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.370	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048856	0.984	anatomical structure development
GO:0050794	0.983	regulation of cellular process
GO:0032501	0.979	multicellular organismal process
GO:0048731	0.969	system development
GO:0007399	0.894	nervous system development
GO:0019222	0.874	regulation of metabolic process
GO:0060255	0.807	regulation of macromolecule metabolic process
GO:0010468	0.801	regulation of gene expression
GO:0080090	0.779	regulation of primary metabolic process
GO:0071840	0.758	cellular component organization or biogenesis
GO:0016043	0.745	cellular component organization
GO:0051171	0.710	regulation of nitrogen compound metabolic process
GO:0031323	0.693	regulation of cellular metabolic process
GO:0030154	0.583	cell differentiation
GO:0008366	0.516	axon ensheathment
GO:0051252	0.516	regulation of RNA metabolic process
GO:0022607	0.363	cellular component assembly
GO:0003008	0.356	system process
GO:0007154	0.347	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0005634	0.999	nucleus
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.955	nuclear lumen
GO:0005654	0.874	nucleoplasm
GO:0005829	0.772	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]