StarFunc result for job id Q9BXM7

User Input

>input (581 residues)
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVG
LGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRR
AVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQ
NLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQE
LVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP
SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAH
RDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPP
DVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLL
ANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXM7	1.000	1.000	9.172E-96	581	1.000	1.000	Q9BXM7.pdb.gz	PINK1_HUMAN Serine/threonine-protein kinase PINK1, mitochondrial OS=Homo sapiens OX=9606 GN=PINK1 PE=1 SV=1
2	AFDB:B5DFG1	0.830	0.831	1.646E-75	580	0.818	0.819	B5DFG1.pdb.gz	PINK1_RAT Serine/threonine-protein kinase PINK1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pink1 PE=1 SV=1
3	AFDB:B5DFT6	0.834	0.844	2.131E-56	574	0.537	0.544	B5DFT6.pdb.gz
4	AFDB:D6WMX4	0.651	0.663	4.690E-40	570	0.327	0.333	D6WMX4.pdb.gz	PINK1_TRICA Serine/threonine-protein kinase Pink1, mitochondrial OS=Tribolium castaneum OX=7070 GN=Pink1 PE=1 SV=1
5	AFDB:E0W1I1	0.675	0.682	3.041E-37	575	0.308	0.311	E0W1I1.pdb.gz	PINK1_PEDHC Serine/threonine-protein kinase Pink1, mitochondrial OS=Pediculus humanus subsp. corporis OX=121224 GN=Pink1 PE=1 SV=1
6	AFDB:Q0KHV6	0.653	0.531	5.643E-36	721	0.339	0.273	Q0KHV6.pdb.gz	PINK1_DROME Serine/threonine-protein kinase Pink1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pink1 PE=1 SV=1
7	AFDB:Q09298	0.610	0.556	8.832E-30	641	0.279	0.253	Q09298.pdb.gz	PINK1_CAEEL Serine/threonine-protein kinase pink-1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pink-1 PE=3 SV=2
8	AFDB:P62345	0.383	0.417	5.430E-10	528	0.129	0.142	P62345.pdb.gz	CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) OX=5823 GN=CDPK4 PE=1 SV=2
9	PDB:6byrA	0.356	0.493	6.645E-10	405	0.110	0.158	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
10	PDB:4krcA	0.354	0.652	6.977E-10	297	0.117	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
11	AFDB:Q9VE06	0.373	0.186	7.634E-10	1213	0.141	0.068	Q9VE06.pdb.gz	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
12	PDB:4rerA	0.331	0.411	9.343E-10	459	0.120	0.153	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
13	AFDB:Q8TDR2	0.382	0.413	9.738E-10	534	0.164	0.178	Q8TDR2.pdb.gz	STK35_HUMAN Serine/threonine-protein kinase 35 OS=Homo sapiens OX=9606 GN=STK35 PE=1 SV=2
14	PDB:2b9iA	0.364	0.600	1.135E-9	338	0.112	0.192	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
15	PDB:2yaaA	0.372	0.673	1.759E-9	300	0.139	0.270	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:1unlA	0.358	0.678	2.138E-9	292	0.115	0.229	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:4zhxA	0.344	0.473	2.863E-9	409	0.117	0.166	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:2h8hA	0.349	0.443	3.313E-9	445	0.110	0.144	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:7cgaA	0.340	0.548	3.313E-9	347	0.127	0.213	7cgaA.pdb.gz
20	PDB:2zoqA	0.382	0.605	4.890E-9	352	0.126	0.207	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DFG1	0.0	952	580	0.819	0.821	PINK1_RAT Serine/threonine-protein kinase PINK1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pink1 PE=1 SV=1
2	Q5PRB2	0.0	564	574	0.549	0.556	Q5PRB2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wu:fc39e12 PE=2 SV=1
3	Q6IS31	0.0	881	558	0.756	0.787	Q6IS31_MOUSE non-specific serine/threonine protein kinase (Fragment) OS=Mus musculus OX=10090 GN=Pink1 PE=2 SV=1
4	Q99MQ3	0.0	945	580	0.814	0.816	PINK1_MOUSE Serine/threonine-protein kinase PINK1, mitochondrial OS=Mus musculus OX=10090 GN=Pink1 PE=1 SV=2
5	Q9BXM7	0.0	1172	581	1.000	1.000	PINK1_HUMAN Serine/threonine-protein kinase PINK1, mitochondrial OS=Homo sapiens OX=9606 GN=PINK1 PE=1 SV=1
6	D3Z9M9	5.98e-120	357	257	0.325	0.735	D3Z9M9_RAT PTEN induced kinase 1 OS=Rattus norvegicus OX=10116 GN=Pink1 PE=4 SV=1
7	E0W1I1	4.11e-86	280	575	0.296	0.299	PINK1_PEDHC Serine/threonine-protein kinase Pink1, mitochondrial OS=Pediculus humanus subsp. corporis OX=121224 GN=Pink1 PE=1 SV=1
8	D6WMX4	7.52e-85	277	570	0.303	0.309	PINK1_TRICA Serine/threonine-protein kinase Pink1, mitochondrial OS=Tribolium castaneum OX=7070 GN=Pink1 PE=1 SV=1
9	Q0KHV6	5.54e-74	252	721	0.232	0.187	PINK1_DROME Serine/threonine-protein kinase Pink1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pink1 PE=1 SV=1
10	Q09298	1.32e-60	214	641	0.263	0.239	PINK1_CAEEL Serine/threonine-protein kinase pink-1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pink-1 PE=3 SV=2
11	P24719	3.42e-12	71.2	497	0.115	0.135	MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEK1 PE=1 SV=1
12	Q7JMV3	3.42e-12	70.9	405	0.115	0.165	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
13	A4V110	9.75e-12	69.3	390	0.105	0.156	A4V110_DROME Calcium/calmodulin-dependent protein kinase I, isoform I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
14	Q8IGW6	1.87e-11	67.4	284	0.083	0.169	Q8IGW6_DROME RE12039p OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=2 SV=1
15	Q0KIF7	1.92e-11	67.4	284	0.083	0.169	Q0KIF7_DROME Calcium/calmodulin-dependent protein kinase I, isoform H OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
16	W0LYS5	3.02e-11	67.4	345	0.086	0.145	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
17	O14328	3.05e-11	68.2	474	0.103	0.127	KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ksp1 PE=1 SV=1
18	Q09013	7.82e-11	67.4	629	0.098	0.091	DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens OX=9606 GN=DMPK PE=1 SV=3
19	P54265	2.34e-10	65.9	631	0.100	0.092	DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus OX=10090 GN=Dmpk PE=1 SV=1
20	O01775	3.19e-10	64.3	357	0.081	0.132	NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans OX=6239 GN=nekl-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	72	14.7	Phosphotransferase enzyme family
2	PF14531 Kinase-like	6.6	17.6	Kinase-like
3	PF00069 Pkinase	1.7e-17	75.3	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2e-08	45.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355865	0.999	E3 ubiquitin-protein ligase parkin
2	9606.ENSP00000355231	0.998	Beclin-1
3	9606.ENSP00000355566	0.998	Mitochondrial import receptor subunit TOM20 homolog
4	9606.ENSP00000235329	0.997	Mitofusin-2
5	9606.ENSP00000418770	0.997	Protein/nucleic acid deglycase DJ-1
6	9606.ENSP00000258080	0.996	Serine protease HTRA2, mitochondrial
7	9606.ENSP00000410339	0.993	Mitochondrial import receptor subunit TOM40 homolog
8	9606.ENSP00000420617	0.993	Mitofusin-1
9	9606.ENSP00000441543	0.993	Polyubiquitin-C
10	9606.ENSP00000335153	0.991	Heat shock protein HSP 90-alpha
11	9606.ENSP00000449089	0.988	Dynamin-1-like protein
12	9606.ENSP00000284320	0.979	Mitochondrial import receptor subunit TOM70
13	9606.ENSP00000265333	0.978	Voltage-dependent anion-selective channel protein 1
14	9606.ENSP00000302564	0.976	Bcl-2-like protein 1
15	9606.ENSP00000298910	0.971	Leucine-rich repeat serine/threonine-protein kinase 2
16	9606.ENSP00000338345	0.970	Alpha-synuclein
17	9606.ENSP00000321971	0.966	Mitochondrial Rho GTPase 2
18	9606.ENSP00000398523	0.965	Calcium-binding and coiled-coil domain-containing protein 2
19	9606.ENSP00000325421	0.963	Presenilins-associated rhomboid-like protein, mitochondrial
20	9606.ENSP00000385824	0.963	Forkhead box protein O3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0046872	0.997	metal ion binding
GO:0031625	0.997	ubiquitin protein ligase binding
GO:0005524	0.995	ATP binding
GO:0000287	0.990	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0009966	0.988	regulation of signal transduction
GO:0031399	0.983	regulation of protein modification process
GO:1901564	0.981	organonitrogen compound metabolic process
GO:0044238	0.979	primary metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0016043	0.975	cellular component organization
GO:0019538	0.972	protein metabolic process
GO:0010941	0.970	regulation of cell death
GO:0051174	0.970	regulation of phosphorus metabolic process
GO:0051247	0.970	positive regulation of protein metabolic process
GO:0048523	0.969	negative regulation of cellular process
GO:0048522	0.969	positive regulation of cellular process
GO:0060548	0.964	negative regulation of cell death
GO:0044093	0.963	positive regulation of molecular function
GO:0019220	0.962	regulation of phosphate metabolic process
GO:1902531	0.961	regulation of intracellular signal transduction
GO:0031401	0.960	positive regulation of protein modification process
GO:0051179	0.953	localization
GO:0051128	0.953	regulation of cellular component organization
GO:0045937	0.953	positive regulation of phosphate metabolic process
GO:0051049	0.952	regulation of transport
GO:0007005	0.951	mitochondrion organization
GO:0018193	0.945	peptidyl-amino acid modification
GO:0010821	0.944	regulation of mitochondrion organization
GO:0016310	0.936	phosphorylation
GO:0042325	0.936	regulation of phosphorylation
GO:0051130	0.934	positive regulation of cellular component organization
GO:0043066	0.934	negative regulation of apoptotic process
GO:0050896	0.930	response to stimulus
GO:1901214	0.928	regulation of neuron death
GO:2000377	0.927	regulation of reactive oxygen species metabolic process
GO:0043085	0.918	positive regulation of catalytic activity
GO:0018105	0.915	peptidyl-serine phosphorylation
GO:0001932	0.909	regulation of protein phosphorylation
GO:0062012	0.908	regulation of small molecule metabolic process
GO:0031329	0.908	regulation of cellular catabolic process
GO:0090140	0.904	regulation of mitochondrial fission
GO:0051716	0.903	cellular response to stimulus
GO:0006950	0.902	response to stress
GO:0051234	0.894	establishment of localization
GO:0051050	0.894	positive regulation of transport
GO:0051641	0.893	cellular localization
GO:0023057	0.883	negative regulation of signaling
GO:0065008	0.879	regulation of biological quality
GO:0010648	0.878	negative regulation of cell communication
GO:0010638	0.878	positive regulation of organelle organization
GO:0051649	0.874	establishment of localization in cell
GO:0042327	0.873	positive regulation of phosphorylation
GO:1901215	0.868	negative regulation of neuron death
GO:0001934	0.864	positive regulation of protein phosphorylation
GO:0009889	0.858	regulation of biosynthetic process
GO:0023056	0.856	positive regulation of signaling
GO:0006810	0.852	transport
GO:0009968	0.851	negative regulation of signal transduction
GO:0006914	0.850	autophagy
GO:0042221	0.849	response to chemical
GO:0031326	0.837	regulation of cellular biosynthetic process
GO:0009892	0.823	negative regulation of metabolic process
GO:1902882	0.815	regulation of response to oxidative stress
GO:0010647	0.813	positive regulation of cell communication
GO:0033554	0.808	cellular response to stress
GO:0010468	0.803	regulation of gene expression
GO:0032502	0.785	developmental process
GO:0048856	0.783	anatomical structure development
GO:0010506	0.776	regulation of autophagy
GO:0019219	0.775	regulation of nucleobase-containing compound metabolic process
GO:0031324	0.773	negative regulation of cellular metabolic process
GO:0070887	0.710	cellular response to chemical stimulus
GO:0010564	0.707	regulation of cell cycle process
GO:0010556	0.691	regulation of macromolecule biosynthetic process
GO:0007154	0.690	cell communication
GO:0048584	0.667	positive regulation of response to stimulus
GO:0022411	0.661	cellular component disassembly
GO:0010605	0.658	negative regulation of macromolecule metabolic process
GO:0007165	0.657	signal transduction
GO:0010822	0.640	positive regulation of mitochondrion organization
GO:0046907	0.635	intracellular transport
GO:0051172	0.624	negative regulation of nitrogen compound metabolic process
GO:1903008	0.580	organelle disassembly
GO:0009895	0.573	negative regulation of catabolic process
GO:0000422	0.570	autophagy of mitochondrion
GO:0008104	0.557	protein localization
GO:0031330	0.554	negative regulation of cellular catabolic process
GO:0048869	0.508	cellular developmental process
GO:0035556	0.502	intracellular signal transduction
GO:0030154	0.498	cell differentiation
GO:0032501	0.432	multicellular organismal process
GO:0046777	0.431	protein autophosphorylation
GO:0009628	0.412	response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	1.000	mitochondrial membrane
GO:0012505	0.997	endomembrane system
GO:0005743	0.994	mitochondrial inner membrane
GO:0005829	0.989	cytosol
GO:0005783	0.958	endoplasmic reticulum
GO:0032991	0.947	protein-containing complex
GO:0098588	0.920	bounding membrane of organelle
GO:0042995	0.666	cell projection
GO:0120025	0.656	plasma membrane bounded cell projection
GO:0005634	0.612	nucleus
GO:0070013	0.584	intracellular organelle lumen
GO:0005741	0.434	mitochondrial outer membrane
GO:0043005	0.396	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]