StarFunc result for job id Q9BXN2

User Input

>input (247 residues)
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXN2	1.000	1.000	2.446E-45	247	1.000	1.000	Q9BXN2.pdb.gz	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
2	AFDB:Q6QLQ4	0.643	0.649	2.944E-29	244	0.595	0.602	Q6QLQ4.pdb.gz	CLC7A_MOUSE C-type lectin domain family 7 member A OS=Mus musculus OX=10090 GN=Clec7a PE=1 SV=3
3	AFDB:Q8NC01	0.498	0.441	1.090E-15	280	0.304	0.268	Q8NC01.pdb.gz	CLC1A_HUMAN C-type lectin domain family 1 member A OS=Homo sapiens OX=9606 GN=CLEC1A PE=1 SV=2
4	AFDB:Q9TTK7	0.488	0.442	6.750E-15	274	0.279	0.252	Q9TTK7.pdb.gz	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
5	AFDB:A0A024RAU0	0.490	0.445	7.188E-15	273	0.296	0.267	A0A024RAU0.pdb.gz
6	AFDB:Q9JL99	0.477	0.513	1.435E-14	229	0.239	0.258	Q9JL99.pdb.gz	CLC1B_MOUSE C-type lectin domain family 1 member B OS=Mus musculus OX=10090 GN=Clec1b PE=1 SV=1
7	AFDB:P26717	0.452	0.482	2.527E-14	231	0.247	0.264	P26717.pdb.gz	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
8	AFDB:D3Z1H5	0.494	0.449	2.866E-14	274	0.247	0.223	D3Z1H5.pdb.gz	D3Z1H5_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
9	AFDB:Q9EQ09	0.479	0.330	4.738E-14	363	0.174	0.118	Q9EQ09.pdb.gz	OLR1_MOUSE Oxidized low-density lipoprotein receptor 1 OS=Mus musculus OX=10090 GN=Olr1 PE=2 SV=2
10	AFDB:Q80ZY1	0.478	0.428	9.461E-14	277	0.231	0.206	Q80ZY1.pdb.gz	Q80ZY1_MOUSE Cd209f protein (Fragment) OS=Mus musculus OX=10090 GN=Cd209f PE=2 SV=1
11	PDB:1qddA	0.452	0.741	3.049E-10	144	0.121	0.208	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
12	PDB:7wz8A	0.447	0.601	2.931E-9	180	0.117	0.161	7wz8A.pdb.gz
13	PDB:4mthA	0.410	0.696	3.769E-9	139	0.146	0.259	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
14	PDB:5f2qB	0.420	0.736	4.551E-9	135	0.126	0.230	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
15	PDB:7qsrA	0.416	0.081	1.244E-8	1335	0.130	0.024	7qsrA.pdb.gz
16	PDB:2kv3A	0.408	0.717	1.503E-8	131	0.121	0.229	2kv3A.pdb.gz
17	PDB:1gz2A	0.411	0.701	2.646E-8	139	0.117	0.209	1gz2A.pdb.gz
18	PDB:1bj3A	0.372	0.682	4.375E-8	129	0.138	0.264	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
19	PDB:1bj3B	0.378	0.723	8.735E-8	123	0.126	0.252	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:3bx4C	0.372	0.664	1.444E-7	134	0.130	0.239	3bx4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BXN2	0.0	507	247	1.000	1.000	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
2	Q6QLQ4	1.75e-93	276	244	0.595	0.602	CLC7A_MOUSE C-type lectin domain family 7 member A OS=Mus musculus OX=10090 GN=Clec7a PE=1 SV=3
3	P78380	8.76e-35	127	273	0.308	0.278	OLR1_HUMAN Oxidized low-density lipoprotein receptor 1 OS=Homo sapiens OX=9606 GN=OLR1 PE=1 SV=1
4	F5H7N8	3.71e-31	116	214	0.235	0.271	F5H7N8_HUMAN Oxidized low density lipoprotein receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=OLR1 PE=1 SV=1
5	Q9P126	8.78e-31	115	229	0.312	0.336	CLC1B_HUMAN C-type lectin domain family 1 member B OS=Homo sapiens OX=9606 GN=CLEC1B PE=1 SV=2
6	Q9TTK7	6.66e-29	112	274	0.206	0.186	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
7	O70156	8.79e-26	105	364	0.206	0.140	OLR1_RAT Oxidized low-density lipoprotein receptor 1 OS=Rattus norvegicus OX=10116 GN=Olr1 PE=2 SV=1
8	Q9EQ09	4.71e-25	103	363	0.198	0.135	OLR1_MOUSE Oxidized low-density lipoprotein receptor 1 OS=Mus musculus OX=10090 GN=Olr1 PE=2 SV=2
9	Q9JL99	3.40e-22	93.2	229	0.291	0.314	CLC1B_MOUSE C-type lectin domain family 1 member B OS=Mus musculus OX=10090 GN=Clec1b PE=1 SV=1
10	Q8CJC7	1.26e-21	91.7	226	0.239	0.261	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
11	Q2HXU8	3.63e-21	91.7	276	0.312	0.279	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
12	Q64329	3.44e-20	88.6	266	0.283	0.263	KLRA3_MOUSE Killer cell lectin-like receptor 3 OS=Mus musculus OX=10090 GN=Klra3 PE=1 SV=2
13	Q8K4F1	1.01e-19	86.7	231	0.243	0.260	Q8K4F1_RAT Killer cell lectin-like receptor subfamily H, member 1 OS=Rattus norvegicus OX=10116 GN=Klrh1 PE=2 SV=1
14	A0A0G2K314	2.12e-19	85.5	220	0.239	0.268	A0A0G2K314_RAT Killer cell lectin-like receptor subfamily H, member 1 OS=Rattus norvegicus OX=10116 GN=Klrh1 PE=4 SV=2
15	Q2TJJ8	6.48e-19	85.1	266	0.271	0.252	Q2TJJ8_MOUSE Killer cell lectin-like receptor subfamily A member 9 OS=Mus musculus OX=10090 GN=Klra9 PE=2 SV=1
16	Q8BRU4	6.50e-19	84.7	238	0.259	0.269	CLC9A_MOUSE C-type lectin domain family 9 member A OS=Mus musculus OX=10090 GN=Clec9a PE=1 SV=1
17	Q80ZC8	4.18e-18	82.4	226	0.247	0.270	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
18	A0A8I6AJ99	7.66e-18	80.5	178	0.198	0.275	A0A8I6AJ99_RAT Killer cell lectin-like receptor subfamily H, member 1 OS=Rattus norvegicus OX=10116 GN=Klrh1 PE=4 SV=1
19	Q9JHV1	9.13e-18	82.0	266	0.287	0.267	Q9JHV1_MOUSE Lectin-related NK cell receptor LY49U OS=Mus musculus OX=10090 GN=Klra21 PE=2 SV=1
20	Q4Z8P5	9.60e-18	82.0	266	0.287	0.267	Q4Z8P5_MOUSE Killer cell lectin-like receptor subfamily A member 21 OS=Mus musculus OX=10090 GN=Klra21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	2.2e+02	12.5	Chordopoxvirus A33R protein
2	PF13903 Claudin_2	17	16.6	PMP-22/EMP/MP20/Claudin tight junction
3	PF00059 Lectin_C	3.9e-14	64.6	Lectin C-type domain
4	PF08391 Ly49	0.0011	30.7	Ly49-like protein, N-terminal region
5	PF05473 UL45	0.058	24.6	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.997	Tyrosine-protein kinase SYK
2	9606.ENSP00000260010	0.994	Toll-like receptor 2
3	9606.ENSP00000254301	0.991	Galectin-3
4	9606.ENSP00000351497	0.990	Low affinity immunoglobulin gamma Fc region receptor II-b
5	9606.ENSP00000363089	0.981	Toll-like receptor 4
6	9606.ENSP00000360797	0.949	Caspase recruitment domain-containing protein 9
7	9606.ENSP00000362680	0.944	Proto-oncogene tyrosine-protein kinase Src
8	9606.ENSP00000482457	0.944	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
9	9606.ENSP00000325708	0.932	Leukocyte antigen CD37
10	9606.ENSP00000378856	0.928	Galectin-9
11	9606.ENSP00000417050	0.900	Tetraspanin
12	9606.ENSP00000401399	0.854	Myeloid differentiation primary response protein MyD88
13	9606.ENSP00000371194	0.831	Lymphocyte-specific protein 1
14	9606.ENSP00000264122	0.800	E3 ubiquitin-protein ligase CBL-B
15	9606.ENSP00000262629	0.780	TYRO protein tyrosine kinase-binding protein
16	9606.ENSP00000299665	0.770	C-type lectin domain family 4 member D
17	9606.ENSP00000354932	0.765	Toll-like receptor 1
18	9606.ENSP00000353874	0.755	Toll-like receptor 9
19	9606.ENSP00000389600	0.719	Toll-like receptor 6
20	9606.ENSP00000319279	0.714	Mucosa-associated lymphoid tissue lymphoma translocation protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038187	1.000	pattern recognition receptor activity
GO:0030247	0.999	polysaccharide binding
GO:0042802	0.996	identical protein binding
GO:0001872	0.578	(1->3)-beta-D-glucan binding
GO:0004888	0.326	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0051239	0.988	regulation of multicellular organismal process
GO:0048518	0.987	positive regulation of biological process
GO:0048583	0.986	regulation of response to stimulus
GO:0002682	0.983	regulation of immune system process
GO:0007165	0.978	signal transduction
GO:0048522	0.975	positive regulation of cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0006950	0.973	response to stress
GO:0010468	0.972	regulation of gene expression
GO:0009605	0.968	response to external stimulus
GO:0048584	0.968	positive regulation of response to stimulus
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0002684	0.963	positive regulation of immune system process
GO:0051240	0.953	positive regulation of multicellular organismal process
GO:0032101	0.952	regulation of response to external stimulus
GO:0001817	0.951	regulation of cytokine production
GO:0010628	0.949	positive regulation of gene expression
GO:0001775	0.947	cell activation
GO:0044419	0.946	biological process involved in interspecies interaction between organisms
GO:0009607	0.944	response to biotic stimulus
GO:0002697	0.940	regulation of immune effector process
GO:0045088	0.936	regulation of innate immune response
GO:0043207	0.928	response to external biotic stimulus
GO:0001819	0.928	positive regulation of cytokine production
GO:0051707	0.917	response to other organism
GO:0002252	0.915	immune effector process
GO:0080090	0.912	regulation of primary metabolic process
GO:0031323	0.907	regulation of cellular metabolic process
GO:0042221	0.902	response to chemical
GO:0050778	0.901	positive regulation of immune response
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0031349	0.894	positive regulation of defense response
GO:0045321	0.881	leukocyte activation
GO:0002764	0.869	immune response-regulating signaling pathway
GO:0002253	0.866	activation of immune response
GO:0002757	0.864	immune response-activating signaling pathway
GO:0006955	0.860	immune response
GO:0045089	0.858	positive regulation of innate immune response
GO:0002703	0.857	regulation of leukocyte mediated immunity
GO:0002768	0.857	immune response-regulating cell surface receptor signaling pathway
GO:0051050	0.855	positive regulation of transport
GO:0002758	0.847	innate immune response-activating signaling pathway
GO:0043085	0.846	positive regulation of catalytic activity
GO:0032675	0.846	regulation of interleukin-6 production
GO:0051247	0.841	positive regulation of protein metabolic process
GO:0032757	0.838	positive regulation of interleukin-8 production
GO:0032755	0.836	positive regulation of interleukin-6 production
GO:0010033	0.813	response to organic substance
GO:0051179	0.812	localization
GO:0002699	0.807	positive regulation of immune effector process
GO:0048519	0.802	negative regulation of biological process
GO:0006952	0.800	defense response
GO:0031325	0.798	positive regulation of cellular metabolic process
GO:0010605	0.791	negative regulation of macromolecule metabolic process
GO:0042327	0.779	positive regulation of phosphorylation
GO:0051234	0.768	establishment of localization
GO:1903555	0.765	regulation of tumor necrosis factor superfamily cytokine production
GO:0006810	0.762	transport
GO:0009966	0.757	regulation of signal transduction
GO:0032680	0.749	regulation of tumor necrosis factor production
GO:0016192	0.738	vesicle-mediated transport
GO:0006909	0.728	phagocytosis
GO:0032729	0.727	positive regulation of type II interferon production
GO:1903557	0.719	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0032653	0.716	regulation of interleukin-10 production
GO:0032760	0.707	positive regulation of tumor necrosis factor production
GO:0031326	0.685	regulation of cellular biosynthetic process
GO:0048523	0.680	negative regulation of cellular process
GO:0032733	0.674	positive regulation of interleukin-10 production
GO:0007155	0.661	cell adhesion
GO:0098581	0.660	detection of external biotic stimulus
GO:0098542	0.653	defense response to other organism
GO:0031341	0.646	regulation of cell killing
GO:0071310	0.629	cellular response to organic substance
GO:0050865	0.599	regulation of cell activation
GO:0010556	0.561	regulation of macromolecule biosynthetic process
GO:0051249	0.527	regulation of lymphocyte activation
GO:0032663	0.473	regulation of interleukin-2 production
GO:1901700	0.449	response to oxygen-containing compound
GO:0019219	0.449	regulation of nucleobase-containing compound metabolic process
GO:0071216	0.421	cellular response to biotic stimulus
GO:0042127	0.378	regulation of cell population proliferation
GO:0010941	0.378	regulation of cell death
GO:0002696	0.377	positive regulation of leukocyte activation
GO:1901701	0.374	cellular response to oxygen-containing compound
GO:0043067	0.368	regulation of programmed cell death
GO:0032502	0.349	developmental process
GO:0008152	0.332	metabolic process
GO:0051251	0.331	positive regulation of lymphocyte activation
GO:0001910	0.328	regulation of leukocyte mediated cytotoxicity
GO:1902531	0.325	regulation of intracellular signal transduction
GO:0009967	0.319	positive regulation of signal transduction
GO:0006355	0.309	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.992	cell surface
GO:0005622	0.990	intracellular anatomical structure
GO:0005737	0.979	cytoplasm
GO:0043231	0.726	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]