StarFunc result for job id Q9BXP5

User Input

>input (876 residues)
MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERRSRGEYRDYDR
NRRERFSPPRHELSPPQKRMRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDV
HIMQHHVLPIQARLGSIAEIDLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFR
RQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDI
DKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKPGEPSKKEEGRAGAGLGDGER
KTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSKKRNRKHSGDD
SFDEGSVSESESESESGQAEEEKEEAEEALKEKEKPKEEEWEKPKDAAGLECKPRPLHKT
CSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICW
NLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWAS
EPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEINVE
RDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGPMPPNRISHGEVL
EWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQELGKDKWLCPLSGK
KFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPGPAQILPPG
LTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFR
GQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXP5	1.000	1.000	0.000	876	1.000	1.000	Q9BXP5.pdb.gz	SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1
2	AFDB:Q5TUF1	0.519	0.472	7.954E-62	967	0.442	0.400	Q5TUF1.pdb.gz	SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae OX=7165 GN=Ars2 PE=3 SV=3
3	AFDB:Q54ZS5	0.340	0.286	5.184E-23	1068	0.232	0.190	Q54ZS5.pdb.gz	Q54ZS5_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277375 PE=3 SV=1
4	AFDB:Q01617	0.089	0.122	2.281E-3	606	0.061	0.087	Q01617.pdb.gz	CPO_DROME Protein couch potato OS=Drosophila melanogaster OX=7227 GN=cpo PE=2 SV=4
5	PDB:7oqcF	0.085	0.257	5.143E-2	267	0.021	0.067	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
6	AFDB:Q8BP71	0.090	0.162	1.006E-1	449	0.080	0.156	Q8BP71.pdb.gz	RFOX2_MOUSE RNA binding protein fox-1 homolog 2 OS=Mus musculus OX=10090 GN=Rbfox2 PE=1 SV=2
7	AFDB:A0A1D8PD58	0.068	0.095	1.176E-1	563	0.071	0.110	A0A1D8PD58.pdb.gz	A0A1D8PD58_CANAL Globin family profile domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C103870CA PE=3 SV=1
8	AFDB:Q9UJQ4	0.055	0.049	1.374E-1	1053	0.113	0.094	Q9UJQ4.pdb.gz	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
9	AFDB:Q9ULJ3	0.061	0.054	1.374E-1	1066	0.121	0.099	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
10	PDB:6lurD	0.084	0.307	1.981E-1	213	0.018	0.075	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
11	PDB:5lsbA	0.079	0.365	2.315E-1	176	0.011	0.057	5lsbA.pdb.gz
12	PDB:5jk5A	0.061	0.124	2.438E-1	400	0.014	0.030	5jk5A.pdb.gz	Phenylalanine hydroxylase from dictyostelium - BH2 complex
13	AFDB:O43027	0.065	0.074	2.696E-1	733	0.104	0.124	O43027.pdb.gz	RGA6_SCHPO Probable Rho-GTPase-activating protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga6 PE=1 SV=1
14	PDB:6gd1A	0.079	0.337	2.705E-1	190	0.014	0.063	6gd1A.pdb.gz
15	AFDB:Q5K8Q8	0.068	0.079	2.839E-1	703	0.123	0.154	Q5K8Q8.pdb.gz	Q5K8Q8_CRYNJ Solute carrier family 35 (UDP-sugar transporter), member A1/2/3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNL04830 PE=4 SV=2
16	PDB:3k57A	0.050	0.054	3.505E-1	782	0.054	0.060	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
17	PDB:5vsuA	0.079	0.172	3.692E-1	387	0.015	0.034	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
18	PDB:7kgbf	0.077	0.528	4.543E-1	95	0.010	0.095	7kgbf.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
19	PDB:3kg0B	0.045	0.274	4.785E-1	98	0.011	0.102	3kg0B.pdb.gz
20	PDB:6qw6R	0.083	0.563	4.785E-1	106	0.009	0.075	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C3A1	0.0	1021	499	0.570	1.000	H7C3A1_HUMAN Arsenite-resistance protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1
2	Q99MR6	0.0	1748	875	0.977	0.978	SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus OX=10090 GN=Srrt PE=1 SV=1
3	Q9BXP5	0.0	1790	876	1.000	1.000	SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1
4	Q5TUF1	1.98e-161	498	967	0.419	0.380	SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae OX=7165 GN=Ars2 PE=3 SV=3
5	Q9V9K7	8.52e-140	441	943	0.307	0.285	SRRT_DROME Serrate RNA effector molecule homolog OS=Drosophila melanogaster OX=7227 GN=Ars2 PE=1 SV=2
6	Q9ZVD0	6.29e-11	68.6	720	0.067	0.082	SRRT_ARATH Serrate RNA effector molecule OS=Arabidopsis thaliana OX=3702 GN=SE PE=1 SV=2
7	Q54ZS5	7.30e-10	65.5	1068	0.061	0.050	Q54ZS5_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277375 PE=3 SV=1
8	O94326	0.002	44.3	609	0.045	0.064	PIR2_SCHPO NURS complex subunit pir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pir2 PE=1 SV=1
9	Q9VB05	0.056	39.7	836	0.051	0.054	Q9VB05_DROME ALG-2 interacting protein X OS=Drosophila melanogaster OX=7227 GN=ALiX PE=1 SV=1
10	Q6FIU8	0.057	39.7	4880	0.033	0.006	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
11	P50851	0.063	39.7	2863	0.079	0.024	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
12	Q8IDX6	0.29	37.4	3130	0.034	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	Q8C9B9	6.7	33.1	2256	0.026	0.010	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
14	C0H4K6	7.2	32.7	3893	0.029	0.006	C0H4K6_PLAF7 E3 ubiquitin-protein ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0704600 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04959 ARS2	1.4e-84	294.7	Arsenite-resistance protein 2
2	PF09726 Macoilin	4.8e+02	10.7	Macoilin family
3	PF00076 RRM_1	67	14.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF12066 SERRATE_Ars2_N	6.1e-37	137.5	SERRATE/Ars2, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326806	0.999	Nuclear cap-binding protein subunit 2
2	9606.ENSP00000364289	0.999	Nuclear cap-binding protein subunit 1
3	9606.ENSP00000297540	0.995	Phosphorylated adapter RNA export protein
4	9606.ENSP00000277541	0.989	Neurogenic locus notch homolog protein 1
5	9606.ENSP00000437256	0.985	Endoribonuclease Dicer
6	9606.ENSP00000230640	0.949	Superkiller viralicidic activity 2-like 2
7	9606.ENSP00000421592	0.946	THO complex subunit 4
8	9606.ENSP00000425979	0.918	Ribonuclease 3
9	9606.ENSP00000355050	0.902	Beta-catenin-like protein 1
10	9606.ENSP00000365439	0.901	Heterogeneous nuclear ribonucleoprotein K
11	9606.ENSP00000266735	0.895	Small nuclear ribonucleoprotein F
12	9606.ENSP00000368017	0.869	Zinc finger C3H1 domain-containing protein
13	9606.ENSP00000373657	0.867	Nuclear cap-binding protein subunit 3
14	9606.ENSP00000379475	0.862	Spliceosome RNA helicase DDX39B
15	9606.ENSP00000216297	0.858	FACT complex subunit SPT16
16	9606.ENSP00000263863	0.839	Granulysin
17	9606.ENSP00000435370	0.837	Ubiquitin-like protein FUBI
18	9606.ENSP00000432083	0.814	Heat shock cognate 71 kDa protein
19	9606.ENSP00000381216	0.813	Far upstream element-binding protein 2
20	9606.ENSP00000416951	0.812	Zinc finger CCCH-type containing 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.998	RNA binding
GO:0030674	0.973	protein-macromolecule adaptor activity
GO:0044877	0.966	protein-containing complex binding
GO:0140262	0.878	mRNA cap binding complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0010467	0.969	gene expression
GO:0090304	0.965	nucleic acid metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0016070	0.944	RNA metabolic process
GO:0006396	0.931	RNA processing
GO:0048519	0.901	negative regulation of biological process
GO:0010605	0.886	negative regulation of macromolecule metabolic process
GO:0050794	0.852	regulation of cellular process
GO:0010629	0.646	negative regulation of gene expression
GO:0034470	0.620	ncRNA processing
GO:0031047	0.607	RNA-mediated gene silencing
GO:0080090	0.600	regulation of primary metabolic process
GO:0051171	0.580	regulation of nitrogen compound metabolic process
GO:0031323	0.566	regulation of cellular metabolic process
GO:0070918	0.556	regulatory ncRNA processing
GO:0035196	0.549	miRNA processing
GO:0051252	0.462	regulation of RNA metabolic process
GO:0048518	0.439	positive regulation of biological process
GO:0048522	0.398	positive regulation of cellular process
GO:0009889	0.374	regulation of biosynthetic process
GO:0031326	0.356	regulation of cellular biosynthetic process
GO:0010556	0.352	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0005737	0.969	cytoplasm
GO:1990904	0.897	ribonucleoprotein complex
GO:0016020	0.323	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]